Data items in the ATOM_SITE category record details about
the atom sites in a macromolecular crystal structure, such as
the positional coordinates, atomic displacement parameters,
magnetic moments and directions.
The data items for describing anisotropic atomic
displacement factors are only used if the corresponding items
are not given in the ATOM_SITE_ANISOTROP category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_siteCategory>
<mmCIF:atom_site id="1">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:label_atom_id>N</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.369</mmCIF:Cartn_x>
<mmCIF:Cartn_y>30.691</mmCIF:Cartn_y>
<mmCIF:Cartn_z>11.795</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.93</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="2">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CA</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.970</mmCIF:Cartn_x>
<mmCIF:Cartn_y>31.965</mmCIF:Cartn_y>
<mmCIF:Cartn_z>12.332</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.75</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="3">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>C</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.569</mmCIF:Cartn_x>
<mmCIF:Cartn_y>32.010</mmCIF:Cartn_y>
<mmCIF:Cartn_z>13.808</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.83</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="4">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>O</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>24.735</mmCIF:Cartn_x>
<mmCIF:Cartn_y>31.190</mmCIF:Cartn_y>
<mmCIF:Cartn_z>14.167</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.53</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="5">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CB</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.379</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.146</mmCIF:Cartn_y>
<mmCIF:Cartn_z>11.540</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.66</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="6">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG1</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.584</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.034</mmCIF:Cartn_y>
<mmCIF:Cartn_z>10.030</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>18.86</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="7">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG2</mmCIF:label_atom_id>
<mmCIF:label_comp_id>VAL</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>11</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>23.933</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.309</mmCIF:Cartn_y>
<mmCIF:Cartn_z>11.872</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.12</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>11</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="8">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:label_atom_id>N</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>26.095</mmCIF:Cartn_x>
<mmCIF:Cartn_y>32.930</mmCIF:Cartn_y>
<mmCIF:Cartn_z>14.590</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>18.97</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="9">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CA</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>25.734</mmCIF:Cartn_x>
<mmCIF:Cartn_y>32.995</mmCIF:Cartn_y>
<mmCIF:Cartn_z>16.032</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>19.80</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="10">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>C</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>24.695</mmCIF:Cartn_x>
<mmCIF:Cartn_y>34.106</mmCIF:Cartn_y>
<mmCIF:Cartn_z>16.113</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.92</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="11">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>O</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>24.869</mmCIF:Cartn_x>
<mmCIF:Cartn_y>35.118</mmCIF:Cartn_y>
<mmCIF:Cartn_z>15.421</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>21.84</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="12">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CB</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>26.911</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.346</mmCIF:Cartn_y>
<mmCIF:Cartn_z>17.018</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.51</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="13">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>OG1</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id>3</mmCIF:label_alt_id>
<mmCIF:Cartn_x>27.946</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.921</mmCIF:Cartn_y>
<mmCIF:Cartn_z>16.183</mmCIF:Cartn_z>
<mmCIF:occupancy>0.50</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.29</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="14">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>OG1</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id>4</mmCIF:label_alt_id>
<mmCIF:Cartn_x>27.769</mmCIF:Cartn_x>
<mmCIF:Cartn_y>32.142</mmCIF:Cartn_y>
<mmCIF:Cartn_z>17.103</mmCIF:Cartn_z>
<mmCIF:occupancy>0.50</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.59</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="15">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG2</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id>3</mmCIF:label_alt_id>
<mmCIF:Cartn_x>27.418</mmCIF:Cartn_x>
<mmCIF:Cartn_y>32.181</mmCIF:Cartn_y>
<mmCIF:Cartn_z>17.878</mmCIF:Cartn_z>
<mmCIF:occupancy>0.50</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.47</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="16">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG2</mmCIF:label_atom_id>
<mmCIF:label_comp_id>THR</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>12</mmCIF:label_seq_id>
<mmCIF:label_alt_id>4</mmCIF:label_alt_id>
<mmCIF:Cartn_x>26.489</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.778</mmCIF:Cartn_y>
<mmCIF:Cartn_z>18.426</mmCIF:Cartn_z>
<mmCIF:occupancy>0.50</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>20.00</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>4</mmCIF:footnote_id>
<mmCIF:auth_seq_id>12</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="17">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:label_atom_id>N</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>23.664</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.855</mmCIF:Cartn_y>
<mmCIF:Cartn_z>16.884</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>22.08</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="18">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CA</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>22.623</mmCIF:Cartn_x>
<mmCIF:Cartn_y>34.850</mmCIF:Cartn_y>
<mmCIF:Cartn_z>17.093</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>23.44</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="19">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>C</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>22.657</mmCIF:Cartn_x>
<mmCIF:Cartn_y>35.113</mmCIF:Cartn_y>
<mmCIF:Cartn_z>18.610</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>25.77</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="20">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>O</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>23.123</mmCIF:Cartn_x>
<mmCIF:Cartn_y>34.250</mmCIF:Cartn_y>
<mmCIF:Cartn_z>19.406</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>26.28</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="21">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CB</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>21.236</mmCIF:Cartn_x>
<mmCIF:Cartn_y>34.463</mmCIF:Cartn_y>
<mmCIF:Cartn_z>16.492</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>22.67</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="22">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG1</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>20.478</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.469</mmCIF:Cartn_y>
<mmCIF:Cartn_z>17.371</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>22.14</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="23">
<mmCIF:group_PDB>ATOM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>CG2</mmCIF:label_atom_id>
<mmCIF:label_comp_id>ILE</mmCIF:label_comp_id>
<mmCIF:label_asym_id>A</mmCIF:label_asym_id>
<mmCIF:label_seq_id>13</mmCIF:label_seq_id>
<mmCIF:label_alt_id xsi:nil="true" />
<mmCIF:Cartn_x>21.357</mmCIF:Cartn_x>
<mmCIF:Cartn_y>33.986</mmCIF:Cartn_y>
<mmCIF:Cartn_z>15.016</mmCIF:Cartn_z>
<mmCIF:occupancy>1.00</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>21.75</mmCIF:B_iso_or_equiv>
<mmCIF:auth_seq_id>13</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="101">
<mmCIF:group_PDB>HETATM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>C1</mmCIF:label_atom_id>
<mmCIF:label_comp_id>APS</mmCIF:label_comp_id>
<mmCIF:label_asym_id>C</mmCIF:label_asym_id>
<mmCIF:label_seq_id xsi:nil="true" />
<mmCIF:label_alt_id>1</mmCIF:label_alt_id>
<mmCIF:Cartn_x>4.171</mmCIF:Cartn_x>
<mmCIF:Cartn_y>29.012</mmCIF:Cartn_y>
<mmCIF:Cartn_z>7.116</mmCIF:Cartn_z>
<mmCIF:occupancy>0.58</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>17.27</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>1</mmCIF:footnote_id>
<mmCIF:auth_seq_id>300</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="102">
<mmCIF:group_PDB>HETATM</mmCIF:group_PDB>
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:label_atom_id>C2</mmCIF:label_atom_id>
<mmCIF:label_comp_id>APS</mmCIF:label_comp_id>
<mmCIF:label_asym_id>C</mmCIF:label_asym_id>
<mmCIF:label_seq_id xsi:nil="true" />
<mmCIF:label_alt_id>1</mmCIF:label_alt_id>
<mmCIF:Cartn_x>4.949</mmCIF:Cartn_x>
<mmCIF:Cartn_y>27.758</mmCIF:Cartn_y>
<mmCIF:Cartn_z>6.793</mmCIF:Cartn_z>
<mmCIF:occupancy>0.58</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>16.95</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>1</mmCIF:footnote_id>
<mmCIF:auth_seq_id>300</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="103">
<mmCIF:group_PDB>HETATM</mmCIF:group_PDB>
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:label_atom_id>O3</mmCIF:label_atom_id>
<mmCIF:label_comp_id>APS</mmCIF:label_comp_id>
<mmCIF:label_asym_id>C</mmCIF:label_asym_id>
<mmCIF:label_seq_id xsi:nil="true" />
<mmCIF:label_alt_id>1</mmCIF:label_alt_id>
<mmCIF:Cartn_x>4.800</mmCIF:Cartn_x>
<mmCIF:Cartn_y>26.678</mmCIF:Cartn_y>
<mmCIF:Cartn_z>7.393</mmCIF:Cartn_z>
<mmCIF:occupancy>0.58</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>16.85</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>1</mmCIF:footnote_id>
<mmCIF:auth_seq_id>300</mmCIF:auth_seq_id>
</mmCIF:atom_site>
<mmCIF:atom_site id="104">
<mmCIF:group_PDB>HETATM</mmCIF:group_PDB>
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:label_atom_id>N4</mmCIF:label_atom_id>
<mmCIF:label_comp_id>APS</mmCIF:label_comp_id>
<mmCIF:label_asym_id>C</mmCIF:label_asym_id>
<mmCIF:label_seq_id xsi:nil="true" />
<mmCIF:label_alt_id>1</mmCIF:label_alt_id>
<mmCIF:Cartn_x>5.930</mmCIF:Cartn_x>
<mmCIF:Cartn_y>27.841</mmCIF:Cartn_y>
<mmCIF:Cartn_z>5.869</mmCIF:Cartn_z>
<mmCIF:occupancy>0.58</mmCIF:occupancy>
<mmCIF:B_iso_or_equiv>16.43</mmCIF:B_iso_or_equiv>
<mmCIF:footnote_id>1</mmCIF:footnote_id>
<mmCIF:auth_seq_id>300</mmCIF:auth_seq_id>
</mmCIF:atom_site>
</mmCIF:atom_siteCategory>
Equivalent isotropic atomic displacement parameter, B~eq~,
in angstroms squared, calculated as the geometric mean of
the anisotropic atomic displacement parameters.
B~eq~ = (B~i~ B~j~ B~k~)^1/3^
B~n~ = the principal components of the orthogonalized B^ij^
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B_equiv_geom_mean in category atom_site.
Isotropic atomic displacement parameter, or equivalent isotropic
atomic displacement parameter, B~eq~, calculated from the
anisotropic displacement parameters.
B~eq~ = (1/3) sum~i~[sum~j~(B^ij^ A~i~ A~j~ a*~i~ a*~j~)]
A = the real space cell lengths
a* = the reciprocal space cell lengths
B^ij^ = 8 pi^2^ U^ij^
Ref: Fischer, R. X. & Tillmanns, E. (1988). Acta Cryst. C44,
775-776.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B_iso_or_equiv in category atom_site.
The x atom-site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The standard uncertainty (estimated standard deviation)
of attribute Cartn_x in category atom_site.
The y atom-site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The standard uncertainty (estimated standard deviation)
of attribute Cartn_y in category atom_site.
The z atom-site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The standard uncertainty (estimated standard deviation)
of attribute Cartn_z in category atom_site.
Equivalent isotropic atomic displacement parameter, U~eq~,
in angstroms squared, calculated as the geometric mean of
the anisotropic atomic displacement parameters.
U~eq~ = (U~i~ U~j~ U~k~)^1/3^
U~n~ = the principal components of the orthogonalized U^ij^
The standard uncertainty (estimated standard deviation)
of attribute U_equiv_geom_mean in category atom_site.
Isotropic atomic displacement parameter, or equivalent isotropic
atomic displacement parameter, U~eq~, calculated from
anisotropic atomic displacement parameters.
U~eq~ = (1/3) sum~i~[sum~j~(U^ij^ A~i~ A~j~ a*~i~ a*~j~)]
A = the real space cell lengths
a* = the reciprocal space cell lengths
Ref: Fischer, R. X. & Tillmanns, E. (1988). Acta Cryst. C44,
775-776.
The standard uncertainty (estimated standard deviation)
of attribute U_iso_or_equiv in category atom_site.
The Wyckoff symbol (letter) as listed in the space-group tables
of International Tables for Crystallography, Vol. A (2002).
A standard code used to describe the type of atomic displacement
parameters used for the site.
The [1][1] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[1][1] in category atom_site.
The [1][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[1][2] in category atom_site.
The [1][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[1][3] in category atom_site.
The [2][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[2][2] in category atom_site.
The [2][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[2][3] in category atom_site.
The [3][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute aniso_B[3][3] in category atom_site.
The [1][1] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[1][1] in category atom_site.
The [1][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[1][2] in category atom_site.
The [1][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[1][3] in category atom_site.
The [2][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[2][2] in category atom_site.
The [2][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[2][3] in category atom_site.
The [3][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute aniso_U[3][3] in category atom_site.
Ratio of the maximum to minimum principal axes of
displacement (thermal) ellipsoids.
The number of hydrogen atoms attached to the atom at this site
excluding any hydrogen atoms for which coordinates (measured or
calculated) are given.
water oxygen
2
hydroxyl oxygen
1
ammonium nitrogen
4
An alternative identifier for attribute label_asym_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_atom_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_comp_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_seq_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
Note that this is not necessarily a number, that the values do
not have to be positive, and that the value does not have to
correspond to the value of attribute label_seq_id in category atom_site. The value
of attribute label_seq_id in category atom_site is required to be a sequential list
of positive integers.
The author may assign values to attribute auth_seq_id in category atom_site in any
desired way. For instance, the values may be used to relate
this structure to a numbering scheme in a homologous structure,
including sequence gaps or insertion codes. Alternatively, a
scheme may be used for a truncated polymer that maintains the
numbering scheme of the full length polymer. In all cases, the
scheme used here must match the scheme used in the publication
that describes the structure.
The attribute id in category atom_site of the atom site to which the
'geometry-calculated' atom site is attached.
A standard code to signal whether the site coordinates have been
determined from the intensities or calculated from the geometry
of surrounding sites, or have been assigned dummy values. The
abbreviation 'c' may be used in place of 'calc'.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
A description of the constraints applied to parameters at this
site during refinement. See also attribute refinement_flags
in category atom_site and attribute ls_number_constraints in category refine.
pop=1.0-pop(Zn3)
A description of special aspects of this site. See also
attribute refinement_flags in category atom_site.
Ag/Si disordered
A code which identifies a cluster of atoms that show long-range
positional disorder but are locally ordered. Within each such
cluster of atoms, attribute disorder_group in category atom_site is used to identify
the sites that are simultaneously occupied. This field is only
needed if there is more than one cluster of disordered atoms
showing independent local order.
*** This data item would not in general be used in a
macromolecular data block. ***
A code which identifies a group of positionally disordered atom
sites that are locally simultaneously occupied. Atoms that are
positionally disordered over two or more sites (e.g. the hydrogen
atoms of a methyl group that exists in two orientations) can
be assigned to two or more groups. Sites belonging to the same
group are simultaneously occupied, but those belonging to
different groups are not. A minus prefix (e.g. '-1') is used to
indicate sites disordered about a special position.
*** This data item would not in general be used in a
macromolecular data block. ***
The value of attribute footnote_id in category atom_site must match an ID
specified by attribute id in category atom_sites_footnote in the
ATOM_SITES_FOOTNOTE list.
The x coordinate of the atom-site position specified as a
fraction of attribute length_a in category cell.
The standard uncertainty (estimated standard deviation)
of attribute fract_x in category atom_site.
The y coordinate of the atom-site position specified as a
fraction of attribute length_b in category cell.
The standard uncertainty (estimated standard deviation)
of attribute fract_y in category atom_site.
The z coordinate of the atom-site position specified as a
fraction of attribute length_c in category cell.
The standard uncertainty (estimated standard deviation)
of attribute fract_z in category atom_site.
The group of atoms to which the atom site belongs. This data
item is provided for compatibility with the original Protein
Data Bank format, and only for that purpose.
A component of the identifier for this atom site.
For further details, see the definition of the ATOM_SITE_ALT
category.
This data item is a pointer to attribute id in category atom_sites_alt in the
ATOM_SITES_ALT category.
A component of the identifier for this atom site.
For further details, see the definition of the STRUCT_ASYM
category.
This data item is a pointer to attribute id in category struct_asym in the
STRUCT_ASYM category.
A component of the identifier for this atom site.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
A component of the identifier for this atom site.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
This data item is a pointer to attribute id in category entity in the ENTITY category.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
The fraction of the atom type present at this site.
The sum of the occupancies of all the atom types at this site
may not significantly exceed 1.0 unless it is a dummy site.
The standard uncertainty (estimated standard deviation)
of attribute occupancy in category atom_site.
PDB atom name.
PDB insertion code.
PDB model number.
PDB residue name.
PDB residue number.
PDB strand id.
Author's alternate location identifier.
Author's atom name.
The NCS domain to which the atom position is assigned.
The NCS group is defined in category struct_ncs_dom.
This item is a reference to attribute id in category struct_ncs_dom.
The TLS group to which the atom position is assigned.
The TLS group is defined in category pdbx_refine_tls_group.
This item is a reference to attribute id in category pdbx_refine_tls_group.
A concatenated series of single-letter codes which indicate the
refinement restraints or constraints applied to this site. This
item should not be used. It has been replaced by
attribute refinement_flags_posn in category atom_site *_adp and *_occupancy. It is
retained in this dictionary only to provide compatibility with
old CIFs.
A code which indicates the refinement restraints or constraints
applied to the atomic displacement parameters of this site.
A code which indicates that refinement restraints or
constraints were applied to the occupancy of this site.
A code which indicates the refinement restraints or constraints
applied to the positional coordinates of this site.
A description of restraints applied to specific parameters at
this site during refinement. See also attribute refinement_flags
in category atom_site and attribute ls_number_restraints in category refine.
restrained to planar ring
The multiplicity of a site due to the space-group symmetry as is
given in International Tables for Crystallography Vol. A (2002).
A standard code used to describe the type of atomic displacement
parameters used for the site.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
The value of attribute id in category atom_site must uniquely identify a record in the
ATOM_SITE list.
Note that this item need not be a number; it can be any unique
identifier.
This data item was introduced to provide compatibility between
small-molecule and macromolecular CIFs. In a small-molecule
CIF, _atom_site_label is the identifier for the atom. In a
macromolecular CIF, the atom identifier is the aggregate of
_atom_site.label_alt_id, _atom_site.label_asym_id,
_atom_site.label_atom_id, _atom_site.label_comp_id and
attribute label_seq_id in category atom_site. For the two types of files to be
compatible, a formal identifier for the category had to be
introduced that was independent of the different modes of
identifying the atoms. For compatibility with older CIFs,
_atom_site_label is aliased to attribute id in category atom_site.
5
C12
Ca3g28
Fe3+17
H*251
boron2a
C_a_phe_83_a_0
Zn_Zn_301_A_0
Data items in the ATOM_SITE_ANISOTROP category record details
about anisotropic displacement parameters.
If the ATOM_SITE_ANISOTROP category is used for storing these
data, the corresponding ATOM_SITE data items are not used.
Example 1 - based on NDB structure BDL005 of Holbrook, Dickerson &
Kim [Acta Cryst. (1985), B41, 255-262].
<mmCIF:atom_site_anisotropCategory>
<mmCIF:atom_site_anisotrop id="1">
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:U11>8642.</mmCIF:U11>
<mmCIF:U12>4866.</mmCIF:U12>
<mmCIF:U13>7299.</mmCIF:U13>
<mmCIF:U22>-342.</mmCIF:U22>
<mmCIF:U23>-258.</mmCIF:U23>
<mmCIF:U33>-1427.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="2">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:U11>5174.</mmCIF:U11>
<mmCIF:U12>4871.</mmCIF:U12>
<mmCIF:U13>6243.</mmCIF:U13>
<mmCIF:U22>-1885.</mmCIF:U22>
<mmCIF:U23>-2051.</mmCIF:U23>
<mmCIF:U33>-1377.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="3">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:U11>6202.</mmCIF:U11>
<mmCIF:U12>5020.</mmCIF:U12>
<mmCIF:U13>4395.</mmCIF:U13>
<mmCIF:U22>-1130.</mmCIF:U22>
<mmCIF:U23>-556.</mmCIF:U23>
<mmCIF:U33>-632.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="4">
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:U11>4224.</mmCIF:U11>
<mmCIF:U12>4700.</mmCIF:U12>
<mmCIF:U13>5046.</mmCIF:U13>
<mmCIF:U22>1105.</mmCIF:U22>
<mmCIF:U23>-161.</mmCIF:U23>
<mmCIF:U33>345.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="5">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:U11>8684.</mmCIF:U11>
<mmCIF:U12>4688.</mmCIF:U12>
<mmCIF:U13>4171.</mmCIF:U13>
<mmCIF:U22>-1850.</mmCIF:U22>
<mmCIF:U23>-433.</mmCIF:U23>
<mmCIF:U33>-292.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="6">
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:U11>11226.</mmCIF:U11>
<mmCIF:U12>5255.</mmCIF:U12>
<mmCIF:U13>3532.</mmCIF:U13>
<mmCIF:U22>-341.</mmCIF:U22>
<mmCIF:U23>2685.</mmCIF:U23>
<mmCIF:U33>1328.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="7">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:U11>10214.</mmCIF:U11>
<mmCIF:U12>2428.</mmCIF:U12>
<mmCIF:U13>5614.</mmCIF:U13>
<mmCIF:U22>-2610.</mmCIF:U22>
<mmCIF:U23>-1940.</mmCIF:U23>
<mmCIF:U33>902.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="8">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:U11>4590.</mmCIF:U11>
<mmCIF:U12>3488.</mmCIF:U12>
<mmCIF:U13>5827.</mmCIF:U13>
<mmCIF:U22>751.</mmCIF:U22>
<mmCIF:U23>-770.</mmCIF:U23>
<mmCIF:U33>986.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
<mmCIF:atom_site_anisotrop id="9">
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:U11>5014.</mmCIF:U11>
<mmCIF:U12>4434.</mmCIF:U12>
<mmCIF:U13>3447.</mmCIF:U13>
<mmCIF:U22>-17.</mmCIF:U22>
<mmCIF:U23>-1593.</mmCIF:U23>
<mmCIF:U33>539.</mmCIF:U33>
</mmCIF:atom_site_anisotrop>
</mmCIF:atom_site_anisotropCategory>
The [1][1] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[1][1] in category atom_site_anisotrop.
The [1][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[1][2] in category atom_site_anisotrop.
The [1][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[1][3] in category atom_site_anisotrop.
The [2][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[2][2] in category atom_site_anisotrop.
The [2][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[2][3] in category atom_site_anisotrop.
The [3][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure-factor term as:
T = exp{-1/4 sum~i~[sum~j~(B^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The standard uncertainty (estimated standard deviation)
of attribute B[3][3] in category atom_site_anisotrop.
The [1][1] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[1][1] in category atom_site_anisotrop.
The [1][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[1][2] in category atom_site_anisotrop.
The [1][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[1][3] in category atom_site_anisotrop.
The [2][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[2][2] in category atom_site_anisotrop.
The [2][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[2][3] in category atom_site_anisotrop.
The [3][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure-factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U^ij^ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The standard uncertainty (estimated standard deviation)
of attribute U[3][3] in category atom_site_anisotrop.
Pointer to attribute pdbx_PDB_ins_code in category atom_site
Pointer to attribute pdbx_auth_alt_id in category atom_site.
Pointer to attribute auth_asym_id in category atom_site
Pointer to attribute auth_atom_id in category atom_site
Pointer to attribute auth_comp_id in category atom_site
Pointer to attribute auth_seq_id in category atom_site
Pointer to attribute label_alt_id in category atom_site.
Pointer to attribute label_asym_id in category atom_site
Pointer to attribute label_atom_id in category atom_site
Pointer to attribute label_comp_id in category atom_site
Pointer to attribute label_seq_id in category atom_site
Ratio of the maximum to minimum principal axes of
displacement (thermal) ellipsoids.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
Data items in the ATOM_SITES category record details about
the crystallographic cell and cell transformations, which are
common to all atom sites.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_sitesCategory>
<mmCIF:atom_sites entry_id="5HVP">
<mmCIF:Cartn_transform_axes>c along z, astar along x, b along y</mmCIF:Cartn_transform_axes>
<mmCIF:Cartn_transf_matrix11>58.39</mmCIF:Cartn_transf_matrix11>
<mmCIF:Cartn_transf_matrix12>0.00</mmCIF:Cartn_transf_matrix12>
<mmCIF:Cartn_transf_matrix13>0.00</mmCIF:Cartn_transf_matrix13>
<mmCIF:Cartn_transf_matrix21>0.00</mmCIF:Cartn_transf_matrix21>
<mmCIF:Cartn_transf_matrix22>86.70</mmCIF:Cartn_transf_matrix22>
<mmCIF:Cartn_transf_matrix23>0.00</mmCIF:Cartn_transf_matrix23>
<mmCIF:Cartn_transf_matrix31>0.00</mmCIF:Cartn_transf_matrix31>
<mmCIF:Cartn_transf_matrix32>0.00</mmCIF:Cartn_transf_matrix32>
<mmCIF:Cartn_transf_matrix33>46.27</mmCIF:Cartn_transf_matrix33>
<mmCIF:Cartn_transf_vector1>0.00</mmCIF:Cartn_transf_vector1>
<mmCIF:Cartn_transf_vector2>0.00</mmCIF:Cartn_transf_vector2>
<mmCIF:Cartn_transf_vector3>0.00</mmCIF:Cartn_transf_vector3>
</mmCIF:atom_sites>
</mmCIF:atom_sitesCategory>
The [1][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1] element of the three-element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2] element of the three-element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3] element of the three-element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
A description of the relative alignment of the crystal cell
axes to the Cartesian orthogonal axes as applied in the
transformation matrix attribute Cartn_transf_matrix[][] in category atom_sites.
a parallel to x; b in the plane of y and z
The [1][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1][2] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][2] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][2] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1] element of the three-element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2] element of the three-element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3] element of the three-element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
This code identifies the method used to locate the
hydrogen atoms.
*** This data item would not in general be used in a
macromolecular data block. ***
This code identifies the method used to locate the initial
atom sites.
*** This data item would not in general be used in a
macromolecular data block. ***
This code identifies the method used to locate the
non-hydrogen-atom sites not found by
attribute solution_primary.
in category atom_sites
*** This data item would not in general be used in a
macromolecular data block. ***
Additional information about the atomic coordinates not coded
elsewhere in the CIF.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the ATOM_SITES_ALT category record details
about the structural ensembles that should be generated from
atom sites or groups of atom sites that are modelled in
alternative conformations in this data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_sites_altCategory>
<mmCIF:atom_sites_alt id="">
<mmCIF:details> Atom sites with the alternative ID set to null are not
modeled in alternative conformations</mmCIF:details>
</mmCIF:atom_sites_alt>
<mmCIF:atom_sites_alt id="1">
<mmCIF:details> Atom sites with the alternative ID set to 1 have been
modeled in alternative conformations with respect to atom
sites marked with alternative ID 2. The conformations of
amino-acid side chains and solvent atoms with alternative
ID set to 1 correlate with the conformation of the
inhibitor marked with alternative ID 1. They have been
given an occupancy of 0.58 to match the occupancy assigned
to the inhibitor.</mmCIF:details>
</mmCIF:atom_sites_alt>
<mmCIF:atom_sites_alt id="2">
<mmCIF:details> Atom sites with the alternative ID set to 2 have been
modeled in alternative conformations with respect to atom
sites marked with alternative ID 1. The conformations of
amino-acid side chains and solvent atoms with alternative
ID set to 2 correlate with the conformation of the
inhibitor marked with alternative ID 2. They have been
given an occupancy of 0.42 to match the occupancy assigned
to the inhibitor.</mmCIF:details>
</mmCIF:atom_sites_alt>
<mmCIF:atom_sites_alt id="3">
<mmCIF:details> Atom sites with the alternative ID set to 3 have been
modeled in alternative conformations with respect to
atoms marked with alternative ID 4. The conformations of
amino-acid side chains and solvent atoms with alternative
ID set to 3 do not correlate with the conformation of the
inhibitor. These atom sites have arbitrarily been given
an occupancy of 0.50.</mmCIF:details>
</mmCIF:atom_sites_alt>
<mmCIF:atom_sites_alt id="4">
<mmCIF:details> Atom sites with the alternative ID set to 4 have been
modeled in alternative conformations with respect to
atoms marked with alternative ID 3. The conformations of
amino-acid side chains and solvent atoms with alternative
ID set to 4 do not correlate with the conformation of the
inhibitor. These atom sites have arbitrarily been given
an occupancy of 0.50.</mmCIF:details>
</mmCIF:atom_sites_alt>
</mmCIF:atom_sites_altCategory>
A description of special aspects of the modelling of atoms in
alternative conformations.
The value of attribute id in category atom_sites_alt must uniquely identify
a record in the ATOM_SITES_ALT list.
Note that this item need not be a number; it can be any unique
identifier.
orientation 1
molecule abc
Data items in the ATOM_SITES_ALT_ENS category record details
about the ensemble structure generated from atoms with various
alternative conformation IDs.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_sites_alt_ensCategory>
<mmCIF:atom_sites_alt_ens id="Ensemble 1-A">
<mmCIF:details> The inhibitor binds to the enzyme in two, roughly twofold
symmetric alternative conformations.
This conformational ensemble includes the more populated
conformation of the inhibitor (ID=1) and the amino-acid
side chains and solvent structure that correlate with this
inhibitor conformation.
Also included are one set (ID=3) of side chains with
alternative conformations when the conformations are not
correlated with the inhibitor conformation.</mmCIF:details>
</mmCIF:atom_sites_alt_ens>
<mmCIF:atom_sites_alt_ens id="Ensemble 1-B">
<mmCIF:details> The inhibitor binds to the enzyme in two, roughly twofold
symmetric alternative conformations.
This conformational ensemble includes the more populated
conformation of the inhibitor (ID=1) and the amino-acid
side chains and solvent structure that correlate with
this inhibitor conformation.
Also included are one set (ID=4) of side chains with
alternative conformations when the conformations are not
correlated with the inhibitor conformation.</mmCIF:details>
</mmCIF:atom_sites_alt_ens>
<mmCIF:atom_sites_alt_ens id="Ensemble 2-A">
<mmCIF:details> The inhibitor binds to the enzyme in two, roughly twofold
symmetric alternative conformations.
This conformational ensemble includes the less populated
conformation of the inhibitor (ID=2) and the amino-acid
side chains and solvent structure that correlate with this
inhibitor conformation.
Also included are one set (ID=3) of side chains with
alternative conformations when the conformations are not
correlated with the inhibitor conformation.</mmCIF:details>
</mmCIF:atom_sites_alt_ens>
<mmCIF:atom_sites_alt_ens id="Ensemble 2-B">
<mmCIF:details> The inhibitor binds to the enzyme in two, roughly twofold
symmetric alternative conformations.
This conformational ensemble includes the less populated
conformation of the inhibitor (ID=2) and the amino-acid
side chains and solvent structure that correlate with this
inhibitor conformation.
Also included are one set (ID=4) of side chains with
alternative conformations when the conformations are not
correlated with the inhibitor conformation.</mmCIF:details>
</mmCIF:atom_sites_alt_ens>
</mmCIF:atom_sites_alt_ensCategory>
A description of special aspects of the ensemble structure
generated from atoms with various alternative IDs.
The value of attribute id in category atom_sites_alt_ens must uniquely identify a
record in the ATOM_SITES_ALT_ENS list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ATOM_SITES_ALT_GEN category record details
about the interpretation of multiple conformations in the
structure.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_sites_alt_genCategory>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id=""></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id="1"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id="3"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id=""></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id="1"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id="4"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id=""></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id="2"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id="3"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id=""></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id="2"></mmCIF:atom_sites_alt_gen>
<mmCIF:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id="4"></mmCIF:atom_sites_alt_gen>
</mmCIF:atom_sites_alt_genCategory>
This data item is a pointer to attribute id in category atom_sites_alt_ens in the
ATOM_SITES_ALT_ENS category.
This data item is a pointer to attribute id in category atom_sites_alt in the
ATOM_SITES_ALT category.
Data items in the ATOM_SITES_FOOTNOTE category record detailed
comments about an atom site or a group of atom sites.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_sites_footnoteCategory>
<mmCIF:atom_sites_footnote id="1">
<mmCIF:text> The inhibitor binds to the enzyme in two alternative
orientations. The two orientations have been assigned
alternative IDs *1* and *2*.</mmCIF:text>
</mmCIF:atom_sites_footnote>
<mmCIF:atom_sites_footnote id="2">
<mmCIF:text> Side chains of these residues adopt alternative
orientations that correlate with the alternative
orientations of the inhibitor.
Side chains with alternative ID *1* and occupancy 0.58
correlate with inhibitor orientation *1*.
Side chains with alternative ID *2* and occupancy 0.42
correlate with inhibitor orientation *2*.</mmCIF:text>
</mmCIF:atom_sites_footnote>
<mmCIF:atom_sites_footnote id="3">
<mmCIF:text> The positions of these water molecules correlate with
the alternative orientations of the inhibitor.
Water molecules with alternative ID *1* and occupancy 0.58
correlate with inhibitor orientation *1*.
Water molecules with alternative ID *2* and occupancy 0.42
correlate with inhibitor orientation *2*.</mmCIF:text>
</mmCIF:atom_sites_footnote>
<mmCIF:atom_sites_footnote id="4">
<mmCIF:text> Side chains of these residues adopt alternative
orientations that do not correlate with the alternative
orientation of the inhibitor.</mmCIF:text>
</mmCIF:atom_sites_footnote>
<mmCIF:atom_sites_footnote id="5">
<mmCIF:text> The positions of these water molecules correlate with
alternative orientations of amino-acid side chains that
do not correlate with alternative orientations of the
inhibitor.</mmCIF:text>
</mmCIF:atom_sites_footnote>
</mmCIF:atom_sites_footnoteCategory>
The text of the footnote. Footnotes are used to describe
an atom site or a group of atom sites in the ATOM_SITE list.
For example, footnotes may be used to indicate atoms for which
the electron density is very weak, or atoms for which static
disorder has been modelled.
A code that identifies the footnote.
a
b
1
2
Data items in the ATOM_TYPE category record details about the
properties of the atoms that occupy the atom sites, such as the
atomic scattering factors.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:atom_typeCategory>
<mmCIF:atom_type symbol="C">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:scat_Cromer_Mann_a1>2.31000</mmCIF:scat_Cromer_Mann_a1>
<mmCIF:scat_Cromer_Mann_a2>20.8439</mmCIF:scat_Cromer_Mann_a2>
<mmCIF:scat_Cromer_Mann_a3>1.02000</mmCIF:scat_Cromer_Mann_a3>
<mmCIF:scat_Cromer_Mann_a4>10.2075</mmCIF:scat_Cromer_Mann_a4>
<mmCIF:scat_Cromer_Mann_b1>1.58860</mmCIF:scat_Cromer_Mann_b1>
<mmCIF:scat_Cromer_Mann_b2>0.568700</mmCIF:scat_Cromer_Mann_b2>
<mmCIF:scat_Cromer_Mann_b3>0.865000</mmCIF:scat_Cromer_Mann_b3>
<mmCIF:scat_Cromer_Mann_b4>51.6512</mmCIF:scat_Cromer_Mann_b4>
<mmCIF:scat_Cromer_Mann_c>0.21560</mmCIF:scat_Cromer_Mann_c>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="N">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:scat_Cromer_Mann_a1>12.2126</mmCIF:scat_Cromer_Mann_a1>
<mmCIF:scat_Cromer_Mann_a2>0.005700</mmCIF:scat_Cromer_Mann_a2>
<mmCIF:scat_Cromer_Mann_a3>3.13220</mmCIF:scat_Cromer_Mann_a3>
<mmCIF:scat_Cromer_Mann_a4>9.89330</mmCIF:scat_Cromer_Mann_a4>
<mmCIF:scat_Cromer_Mann_b1>2.01250</mmCIF:scat_Cromer_Mann_b1>
<mmCIF:scat_Cromer_Mann_b2>28.9975</mmCIF:scat_Cromer_Mann_b2>
<mmCIF:scat_Cromer_Mann_b3>1.16630</mmCIF:scat_Cromer_Mann_b3>
<mmCIF:scat_Cromer_Mann_b4>0.582600</mmCIF:scat_Cromer_Mann_b4>
<mmCIF:scat_Cromer_Mann_c>-11.529</mmCIF:scat_Cromer_Mann_c>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="O">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:scat_Cromer_Mann_a1>3.04850</mmCIF:scat_Cromer_Mann_a1>
<mmCIF:scat_Cromer_Mann_a2>13.2771</mmCIF:scat_Cromer_Mann_a2>
<mmCIF:scat_Cromer_Mann_a3>2.28680</mmCIF:scat_Cromer_Mann_a3>
<mmCIF:scat_Cromer_Mann_a4>5.70110</mmCIF:scat_Cromer_Mann_a4>
<mmCIF:scat_Cromer_Mann_b1>1.54630</mmCIF:scat_Cromer_Mann_b1>
<mmCIF:scat_Cromer_Mann_b2>0.323900</mmCIF:scat_Cromer_Mann_b2>
<mmCIF:scat_Cromer_Mann_b3>0.867000</mmCIF:scat_Cromer_Mann_b3>
<mmCIF:scat_Cromer_Mann_b4>32.9089</mmCIF:scat_Cromer_Mann_b4>
<mmCIF:scat_Cromer_Mann_c>0.250800</mmCIF:scat_Cromer_Mann_c>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="S">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:scat_Cromer_Mann_a1>6.90530</mmCIF:scat_Cromer_Mann_a1>
<mmCIF:scat_Cromer_Mann_a2>1.46790</mmCIF:scat_Cromer_Mann_a2>
<mmCIF:scat_Cromer_Mann_a3>5.20340</mmCIF:scat_Cromer_Mann_a3>
<mmCIF:scat_Cromer_Mann_a4>22.2151</mmCIF:scat_Cromer_Mann_a4>
<mmCIF:scat_Cromer_Mann_b1>1.43790</mmCIF:scat_Cromer_Mann_b1>
<mmCIF:scat_Cromer_Mann_b2>0.253600</mmCIF:scat_Cromer_Mann_b2>
<mmCIF:scat_Cromer_Mann_b3>1.58630</mmCIF:scat_Cromer_Mann_b3>
<mmCIF:scat_Cromer_Mann_b4>56.1720</mmCIF:scat_Cromer_Mann_b4>
<mmCIF:scat_Cromer_Mann_c>0.866900</mmCIF:scat_Cromer_Mann_c>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="CL">
<mmCIF:oxidation_number>-1</mmCIF:oxidation_number>
<mmCIF:scat_Cromer_Mann_a1>18.2915</mmCIF:scat_Cromer_Mann_a1>
<mmCIF:scat_Cromer_Mann_a2>0.006600</mmCIF:scat_Cromer_Mann_a2>
<mmCIF:scat_Cromer_Mann_a3>7.20840</mmCIF:scat_Cromer_Mann_a3>
<mmCIF:scat_Cromer_Mann_a4>1.17170</mmCIF:scat_Cromer_Mann_a4>
<mmCIF:scat_Cromer_Mann_b1>6.53370</mmCIF:scat_Cromer_Mann_b1>
<mmCIF:scat_Cromer_Mann_b2>19.5424</mmCIF:scat_Cromer_Mann_b2>
<mmCIF:scat_Cromer_Mann_b3>2.33860</mmCIF:scat_Cromer_Mann_b3>
<mmCIF:scat_Cromer_Mann_b4>60.4486</mmCIF:scat_Cromer_Mann_b4>
<mmCIF:scat_Cromer_Mann_c>-16.378</mmCIF:scat_Cromer_Mann_c>
</mmCIF:atom_type>
</mmCIF:atom_typeCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:atom_typeCategory>
<mmCIF:atom_type symbol="C">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:number_in_cell>72</mmCIF:number_in_cell>
<mmCIF:scat_dispersion_real>.017</mmCIF:scat_dispersion_real>
<mmCIF:scat_dispersion_imag>.009</mmCIF:scat_dispersion_imag>
<mmCIF:scat_source>International_Tables_Vol_IV_Table_2.2B</mmCIF:scat_source>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="H">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:number_in_cell>100</mmCIF:number_in_cell>
<mmCIF:scat_dispersion_real>0.</mmCIF:scat_dispersion_real>
<mmCIF:scat_dispersion_imag>0.</mmCIF:scat_dispersion_imag>
<mmCIF:scat_source>International_Tables_Vol_IV_Table_2.2B</mmCIF:scat_source>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="O">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:number_in_cell>12</mmCIF:number_in_cell>
<mmCIF:scat_dispersion_real>.047</mmCIF:scat_dispersion_real>
<mmCIF:scat_dispersion_imag>.032</mmCIF:scat_dispersion_imag>
<mmCIF:scat_source>International_Tables_Vol_IV_Table_2.2B</mmCIF:scat_source>
</mmCIF:atom_type>
<mmCIF:atom_type symbol="N">
<mmCIF:oxidation_number>0</mmCIF:oxidation_number>
<mmCIF:number_in_cell>4</mmCIF:number_in_cell>
<mmCIF:scat_dispersion_real>.029</mmCIF:scat_dispersion_real>
<mmCIF:scat_dispersion_imag>.018</mmCIF:scat_dispersion_imag>
<mmCIF:scat_source>International_Tables_Vol_IV_Table_2.2B</mmCIF:scat_source>
</mmCIF:atom_type>
</mmCIF:atom_typeCategory>
Mass percentage of this atom type derived from chemical analysis.
A description of the atom(s) designated by this atom type. In
most cases, this is the element name and oxidation state of
a single atom species. For disordered or nonstoichiometric
structures it will describe a combination of atom species.
deuterium
0.34Fe+0.66Ni
Total number of atoms of this atom type in the unit cell.
Formal oxidation state of this atom type in the structure.
The effective intramolecular bonding radius in angstroms
of this atom type.
The effective intermolecular bonding radius in angstroms
of this atom type.
The Cromer-Mann scattering-factor coefficient a1 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient a2 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient a3 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient a4 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient b1 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient b2 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient b3 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient b4 used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The Cromer-Mann scattering-factor coefficient c used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography (1974).
Vol. IV, Table 2.2B
or: International Tables for Crystallography (2004). Vol. C,
Tables 6.1.1.4 and 6.1.1.5.
The imaginary component of the anomalous-dispersion
scattering factor, f'', in electrons for this atom type and
the radiation identified by attribute id in category diffrn_radiation_wavelength.
The real component of the anomalous-dispersion
scattering factor, f', in electrons for this atom type and
the radiation identified by attribute id in category diffrn_radiation_wavelength.
Reference to the source of the real and imaginary dispersion
corrections for scattering factors used for this atom type.
International Tables Vol. IV Table 2.3.1
The bound coherent scattering length in femtometres for the
atom type at the isotopic composition used for the diffraction
experiment.
Reference to the source of the scattering factors or scattering
lengths used for this atom type.
International Tables Vol. IV Table 2.4.6B
A table of scattering factors as a function of sin theta over
lambda. This table should be well commented to indicate the
items present. Regularly formatted lists are strongly
recommended.
The code used to identify the atom species (singular or plural)
representing this atom type. Normally this code is the element
symbol. The code may be composed of any character except
an underscore with the additional proviso that digits designate
an oxidation state and must be followed by a + or - character.
C
Cu2+
H(SDS)
dummy
FeNi
Data items in the AUDIT category record details about the
creation and subsequent updating of the data block.
Note that these items apply only to the creation and updating of
the data block, and should not be confused with the data items
in the JOURNAL category that record different stages in the
publication of the material in the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:auditCategory>
<mmCIF:audit revision_id="1">
<mmCIF:creation_date>1992-12-08</mmCIF:creation_date>
<mmCIF:creation_method> Created by hand from PDB entry 5HVP, from the J. Biol.
Chem. paper describing this structure and from
laboratory records</mmCIF:creation_method>
<mmCIF:update_record> 1992-12-09 adjusted to reflect comments from B. McKeever
1992-12-10 adjusted to reflect comments from H. Berman
1992-12-12 adjusted to reflect comments from K. Watenpaugh</mmCIF:update_record>
</mmCIF:audit>
</mmCIF:auditCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:auditCategory>
<mmCIF:audit>
<mmCIF:creation_date>1991-03-20</mmCIF:creation_date>
<mmCIF:creation_method>from_xtal_archive_file_using_CIFIO</mmCIF:creation_method>
<mmCIF:update_record> 1991-04-09 text and data added by Tony Willis.
1991-04-15 rec'd by co-editor as manuscript HL0007.
1991-04-17 adjustments based on first referee report.
1991-04-18 adjustments based on second referee report.</mmCIF:update_record>
</mmCIF:audit>
</mmCIF:auditCategory>
A date that the data block was created. The date format is
yyyy-mm-dd.
1990-07-12
A description of how data were entered into the data block.
spawned by the program QBEE
A record of any changes to the data block. The update format is
a date (yyyy-mm-dd) followed by a description of the changes.
The latest update entry is added to the bottom of this record.
1990-07-15 Updated by the Co-editor
The value of attribute revision_id in category audit must uniquely identify a record
in the AUDIT list.
rev1
Data items in the AUDIT_AUTHOR category record details about
the author(s) of the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:audit_authorCategory>
<mmCIF:audit_author name="Fitzgerald, Paula M.D.">
<mmCIF:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</mmCIF:address>
</mmCIF:audit_author>
<mmCIF:audit_author name="McKeever, Brian M.">
<mmCIF:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</mmCIF:address>
</mmCIF:audit_author>
<mmCIF:audit_author name="Van Middlesworth, J.F.">
<mmCIF:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</mmCIF:address>
</mmCIF:audit_author>
<mmCIF:audit_author name="Springer, James P.">
<mmCIF:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</mmCIF:address>
</mmCIF:audit_author>
</mmCIF:audit_authorCategory>
The address of an author of this data block. If there are
multiple authors, attribute address in category audit_author is looped with
attribute name in category audit_author.
Department
Institute
Street
City and postcode
COUNTRY
The name of an author of this data block. If there are multiple
authors, _audit_author.name is looped with _audit_author.address.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the AUDIT_CONFORM category describe the
dictionary versions against which the data names appearing in
the current data block are conformant.
Example 1 - any file conforming to the current CIF core dictionary.
<mmCIF:audit_conformCategory>
<mmCIF:audit_conform dict_name="cif_core.dic" dict_version="2.3.1">
<mmCIF:dict_location>ftp://ftp.iucr.org/pub/cif_core.2.3.1.dic</mmCIF:dict_location>
</mmCIF:audit_conform>
</mmCIF:audit_conformCategory>
A file name or uniform resource locator (URL) for the
dictionary to which the current data block conforms.
The string identifying the highest-level dictionary defining
data names used in this file.
The version number of the dictionary to which the current
data block conforms.
Data items in the AUDIT_CONTACT_AUTHOR category record details
about the name and address of the author to be contacted
concerning the content of this data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:audit_contact_authorCategory>
<mmCIF:audit_contact_author name="Fitzgerald, Paula M.D.">
<mmCIF:address> Department of Biophysical Chemistry
Merck Research Laboratories
PO Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</mmCIF:address>
<mmCIF:phone>1(908)5945510</mmCIF:phone>
<mmCIF:fax>1(908)5946645</mmCIF:fax>
<mmCIF:email>paula_fitzgerald@merck.com</mmCIF:email>
</mmCIF:audit_contact_author>
</mmCIF:audit_contact_authorCategory>
The mailing address of the author of the data block to whom
correspondence should be addressed.
Department
Institute
Street
City and postcode
COUNTRY
The electronic mail address of the author of the data block to
whom correspondence should be addressed, in a form recognizable
to international networks. The format of e-mail
addresses is given in Section 3.4, Address Specification, of
Internet Message Format, RFC 2822, P. Resnick (Editor),
Network Standards Group, April 2001.
name@host.domain.country
bm@iucr.org
The facsimile telephone number of the author of the data
block to whom correspondence should be addressed.
The recommended style starts with the international dialing
prefix, followed by the area code in parentheses, followed by the
local number with no spaces.
12(34)9477334
12()349477334
The telephone number of the author of the data block to whom
correspondence should be addressed.
The recommended style starts with the international dialing
prefix, followed by the area code in parentheses, followed by the
local number and any extension number prefixed by 'x',
with no spaces.
12(34)9477330
12()349477330
12(34)9477330x5543
The name of the author of the data block to whom correspondence
should be addressed.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the AUDIT_LINK category record details about the
relationships between data blocks in the current CIF.
Example 1 - multiple structure paper, as illustrated
in A Guide to CIF for Authors (1995). IUCr: Chester.
<mmCIF:audit_linkCategory>
<mmCIF:audit_link block_code="" block_description="discursive text of paper with two structures"></mmCIF:audit_link>
<mmCIF:audit_link block_code="morA_(1)" block_description="structure 1 of 2"></mmCIF:audit_link>
<mmCIF:audit_link block_code="morA_(2)" block_description="structure 2 of 2"></mmCIF:audit_link>
</mmCIF:audit_linkCategory>
Example 2 - example file for the one-dimensional incommensurately
modulated structure of K~2~SeO~4~.
<mmCIF:audit_linkCategory>
<mmCIF:audit_link block_code="" block_description="publication details"></mmCIF:audit_link>
<mmCIF:audit_link block_code="KSE_COM" block_description="experimental data common to ref./mod. structures"></mmCIF:audit_link>
<mmCIF:audit_link block_code="KSE_REF" block_description="reference structure"></mmCIF:audit_link>
<mmCIF:audit_link block_code="KSE_MOD" block_description="modulated structure"></mmCIF:audit_link>
</mmCIF:audit_linkCategory>
The value of attribute code in category audit_block associated with a data block
in the current file related to the current data block. The
special value '.' may be used to refer to the current data
block for completeness.
A textual description of the relationship of the referenced
data block to the current one.
Data items in the CELL category record details about the
crystallographic cell parameters.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:cellCategory>
<mmCIF:cell entry_id="5HVP">
<mmCIF:length_a>58.39</mmCIF:length_a>
<mmCIF:length_a_esd>0.05</mmCIF:length_a_esd>
<mmCIF:length_b>86.70</mmCIF:length_b>
<mmCIF:length_b_esd>0.12</mmCIF:length_b_esd>
<mmCIF:length_c>46.27</mmCIF:length_c>
<mmCIF:length_c_esd>0.06</mmCIF:length_c_esd>
<mmCIF:angle_alpha>90.00</mmCIF:angle_alpha>
<mmCIF:angle_beta>90.00</mmCIF:angle_beta>
<mmCIF:angle_gamma>90.00</mmCIF:angle_gamma>
<mmCIF:volume>234237.</mmCIF:volume>
<mmCIF:details> The cell parameters were refined every twenty frames during
data integration. The cell lengths given are the mean of
55 such refinements; the esds given are the root mean
square deviations of these 55 observations from that mean.</mmCIF:details>
</mmCIF:cell>
</mmCIF:cellCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:cellCategory>
<mmCIF:cell>
<mmCIF:length_a>5.959</mmCIF:length_a>
<mmCIF:length_a_esd>0.001</mmCIF:length_a_esd>
<mmCIF:length_b>14.956</mmCIF:length_b>
<mmCIF:length_b_esd>0.001</mmCIF:length_b_esd>
<mmCIF:length_c>19.737</mmCIF:length_c>
<mmCIF:length_c_esd>0.003</mmCIF:length_c_esd>
<mmCIF:angle_alpha>90.0</mmCIF:angle_alpha>
<mmCIF:angle_beta>90.0</mmCIF:angle_beta>
<mmCIF:angle_gamma>90.0</mmCIF:angle_gamma>
<mmCIF:volume>1759.0</mmCIF:volume>
<mmCIF:volume_esd>0.3</mmCIF:volume_esd>
</mmCIF:cell>
</mmCIF:cellCategory>
The number of the polymeric chains in a unit cell. In the case
of heteropolymers, Z is the number of occurrences of the most
populous chain.
This data item is provided for compatibility with the original
Protein Data Bank format, and only for that purpose.
Unit-cell angle alpha of the reported structure in degrees.
The standard uncertainty (estimated standard deviation)
of attribute angle_alpha in category cell.
Unit-cell angle beta of the reported structure in degrees.
The standard uncertainty (estimated standard deviation)
of attribute angle_beta in category cell.
Unit-cell angle gamma of the reported structure in degrees.
The standard uncertainty (estimated standard deviation)
of attribute angle_gamma in category cell.
A description of special aspects of the cell choice, noting
possible alternative settings.
pseudo-orthorhombic
standard setting from 45 deg rotation around c
The number of the formula units in the unit cell as specified
by _chemical_formula.structural, _chemical_formula.moiety or
attribute sum in category chemical_formula.
Unit-cell length a corresponding to the structure reported in
angstroms.
The standard uncertainty (estimated standard deviation)
of attribute length_a in category cell.
Unit-cell length b corresponding to the structure reported in
angstroms.
The standard uncertainty (estimated standard deviation)
of attribute length_b in category cell.
Unit-cell length c corresponding to the structure reported in
angstroms.
The standard uncertainty (estimated standard deviation)
of attribute length_c in category cell.
To further identify unique axis if necessary. E.g., P 21 with
an unique C axis will have 'C' in this field.
The angle (recip-alpha) defining the reciprocal cell in degrees.
(recip-alpha), (recip-alpha) and (recip-alpha) related to the
angles in the real cell by:
cos(recip-alpha)
= [cos(beta)*cos(gamma) - cos(alpha)]/[sin(beta)*sin(gamma)]
cos(recip-beta)
= [cos(gamma)*cos(alpha) - cos(beta)]/[sin(gamma)*sin(alpha)]
cos(recip-gamma)
= [cos(alpha)*cos(beta) - cos(gamma)]/[sin(alpha)*sin(beta)]
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_angle_alpha in category cell.
The angle (recip-beta) defining the reciprocal cell in degrees.
(recip-alpha), (recip-alpha) and (recip-alpha) related to the
angles in the real cell by:
cos(recip-alpha)
= [cos(beta)*cos(gamma) - cos(alpha)]/[sin(beta)*sin(gamma)]
cos(recip-beta)
= [cos(gamma)*cos(alpha) - cos(beta)]/[sin(gamma)*sin(alpha)]
cos(recip-gamma)
= [cos(alpha)*cos(beta) - cos(gamma)]/[sin(alpha)*sin(beta)]
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_angle_beta in category cell.
The angle (recip-gamma) defining the reciprocal cell in degrees.
(recip-alpha), (recip-alpha) and (recip-alpha) related to the
angles in the real cell by:
cos(recip-alpha)
= [cos(beta)*cos(gamma) - cos(alpha)]/[sin(beta)*sin(gamma)]
cos(recip-beta)
= [cos(gamma)*cos(alpha) - cos(beta)]/[sin(gamma)*sin(alpha)]
cos(recip-gamma)
= [cos(alpha)*cos(beta) - cos(gamma)]/[sin(alpha)*sin(beta)]
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_angle_gamma in category cell.
The reciprocal cell length (recip-a) in inverse Angstroms.
(recip-a), (recip-b) and (recip-c) are related to the real cell
by the following equation:
recip-a = b*c*sin(alpha)/V
recip-b = c*a*sin(beta)/V
recip-c = a*b*sin(gamma)/V
where V is the cell volume.
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_length_a in category cell.
The reciprocal cell length (recip-b) in inverse Angstroms.
(recip-a), (recip-b) and (recip-c) are related to the real cell
by the following equation:
recip-a = b*c*sin(alpha)/V
recip-b = c*a*sin(beta)/V
recip-c = a*b*sin(gamma)/V
where V is the cell volume.
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_length_b in category cell.
The reciprocal cell length (recip-c) in inverse Angstroms.
(recip-a), (recip-b) and (recip-c) are related to the real cell
by the following equation:
recip-a = b*c*sin(alpha)/V
recip-b = c*a*sin(beta)/V
recip-c = a*b*sin(gamma)/V
where V is the cell volume.
Ref: Buerger, M. J. (1942). X-ray Crystallography, p. 360.
New York: John Wiley & Sons Inc.
The estimated standard deviation of attribute reciprocal_length_c in category cell.
Cell volume V in angstroms cubed.
V = a b c (1 - cos^2^~alpha~ - cos^2^~beta~ - cos^2^~gamma~
+ 2 cos~alpha~ cos~beta~ cos~gamma~)^1/2^
a = attribute length_a
in category cell b = attribute length_b
in category cell c = attribute length_c
in category cell alpha = attribute angle_alpha
in category cell beta = attribute angle_beta
in category cell gamma = attribute angle_gamma in category cell
The standard uncertainty (estimated standard deviation)
of attribute volume in category cell.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CELL_MEASUREMENT category record details
about the measurement of the crystallographic cell parameters.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:cell_measurementCategory>
<mmCIF:cell_measurement entry_id="5HVP">
<mmCIF:temp>293.</mmCIF:temp>
<mmCIF:temp_esd>3.</mmCIF:temp_esd>
<mmCIF:theta_min>11.</mmCIF:theta_min>
<mmCIF:theta_max>31.</mmCIF:theta_max>
<mmCIF:wavelength>1.54</mmCIF:wavelength>
</mmCIF:cell_measurement>
</mmCIF:cell_measurementCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:cell_measurementCategory>
<mmCIF:cell_measurement>
<mmCIF:temp>293.</mmCIF:temp>
<mmCIF:reflns_used>25</mmCIF:reflns_used>
<mmCIF:theta_min>25.</mmCIF:theta_min>
<mmCIF:theta_max>31.</mmCIF:theta_max>
</mmCIF:cell_measurement>
</mmCIF:cell_measurementCategory>
The pressure in kilopascals at which the unit-cell parameters
were measured (not the pressure at which the sample was
synthesized).
The standard uncertainty (estimated standard deviation)
of attribute pressure in category cell_measurement.
Description of the radiation used to measure the unit-cell data.
See also attribute wavelength in category cell_measurement.
neutron
Cu K\a
synchrotron
The total number of reflections used to determine the unit cell.
These reflections may be specified as CELL_MEASUREMENT_REFLN
data items.
The temperature in kelvins at which the unit-cell parameters
were measured (not the temperature of synthesis).
The standard uncertainty (estimated standard deviation)
of attribute temp in category cell_measurement.
The maximum theta angle of reflections used to measure
the unit cell in degrees.
The minimum theta angle of reflections used to measure
the unit cell in degrees.
The wavelength in angstroms of the radiation used to measure
the unit cell. If this is not specified, the wavelength is
assumed to be that specified in the category
DIFFRN_RADIATION_WAVELENGTH.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CELL_MEASUREMENT_REFLN category record
details about the reflections used to determine the
crystallographic cell parameters.
The CELL_MEASUREMENT_REFLN data items would in general be used
only for diffractometer data.
Example 1 - extracted from the CAD-4 listing of Rb~2~S~2~O~6~ at room
temperature (unpublished).
<mmCIF:cell_measurement_reflnCategory>
<mmCIF:cell_measurement_refln index_h="-2" index_k="4" index_l="1">
<mmCIF:theta>8.67</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="0" index_k="3" index_l="2">
<mmCIF:theta>9.45</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="3" index_k="0" index_l="2">
<mmCIF:theta>9.46</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="-3" index_k="4" index_l="1">
<mmCIF:theta>8.93</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="-2" index_k="1" index_l="-2">
<mmCIF:theta>7.53</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="10" index_k="0" index_l="0">
<mmCIF:theta>23.77</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="0" index_k="10" index_l="0">
<mmCIF:theta>23.78</mmCIF:theta>
</mmCIF:cell_measurement_refln>
<mmCIF:cell_measurement_refln index_h="-5" index_k="4" index_l="1">
<mmCIF:theta>11.14</mmCIF:theta>
</mmCIF:cell_measurement_refln>
</mmCIF:cell_measurement_reflnCategory>
Theta angle for a reflection used for measurement of
the unit cell in degrees.
Miller index h of a reflection used for measurement of the unit
cell.
Miller index k of a reflection used for measurement of the unit
cell.
Miller index l of a reflection used for measurement of the unit
cell.
Data items in the CHEM_COMP category give details about each
of the chemical components from which the relevant chemical
structures can be constructed, such as name, mass or charge.
The related categories CHEM_COMP_ATOM, CHEM_COMP_BOND,
CHEM_COMP_ANGLE etc. describe the detailed geometry of these
chemical components.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_compCategory>
<mmCIF:chem_comp id="phe">
<mmCIF:model_source>1987 Protin/Prolsq Ideals file</mmCIF:model_source>
<mmCIF:name>phenylalanine</mmCIF:name>
</mmCIF:chem_comp>
<mmCIF:chem_comp id="val">
<mmCIF:model_source>1987 Protin/Prolsq Ideals file</mmCIF:model_source>
<mmCIF:name>alanine</mmCIF:name>
</mmCIF:chem_comp>
</mmCIF:chem_compCategory>
The formula for the chemical component. Formulae are written
according to the following rules:
(1) Only recognized element symbols may be used.
(2) Each element symbol is followed by a 'count' number. A count
of '1' may be omitted.
(3) A space or parenthesis must separate each cluster of
(element symbol + count), but in general parentheses are
not used.
(4) The order of elements depends on whether carbon is
present or not. If carbon is present, the order should be:
C, then H, then the other elements in alphabetical order
of their symbol. If carbon is not present, the elements
are listed purely in alphabetic order of their symbol. This
is the 'Hill' system used by Chemical Abstracts.
C18 H19 N7 O8 S
Formula mass in daltons of the chemical component.
A description of special aspects of the generation of the
coordinates for the model of the component.
geometry idealized but not minimized
A pointer to an external reference file from which the atomic
description of the component is taken.
The source of the coordinates for the model of the component.
CSD entry ABCDEF
built using Quanta/Charmm
A description of the class of a nonstandard monomer if the
nonstandard monomer represents a modification of a
standard monomer.
iodinated base
phosphorylated amino acid
brominated base
modified amino acid
glycosylated amino acid
A description of special details of a nonstandard monomer.
'yes' indicates that this is a 'standard' monomer, 'no'
indicates that it is 'nonstandard'. Nonstandard monomers
should be described in more detail using the
_chem_comp.mon_nstd_parent, _chem_comp.mon_nstd_class and
attribute mon_nstd_details in category chem_comp data items.
The name of the parent monomer of the nonstandard monomer,
if the nonstandard monomer represents a modification of a
standard monomer.
tyrosine
cytosine
The identifier for the parent component of the nonstandard
component. May be be a comma separated list if this component
is derived from multiple components.
Items in this indirectly point to attribute id in category chem_comp in
the CHEM_COMP category.
The full name of the component.
alanine
valine
adenine
cytosine
The total number of atoms in the component.
The number of non-hydrogen atoms in the component.
For standard polymer components, the one-letter code for
the component. If there is not a standard one-letter code
for this component, or if this is a non-polymer
component, the one-letter code should be given as 'X'.
This code may be preceded by a '+' character to indicate
that the component is a modification of a standard
component.
alanine or adenine
A
ambiguous asparagine/aspartic acid
B
arginine
R
asparagine
N
aspartic acid
D
cysteine or cystine or cytosine
C
glutamine
Q
glutamic acid
E
ambiguous glutamine/glutamic acid
Z
glycine or guanine
G
histidine
H
isoleucine
I
leucine
L
lysine
K
methionine
M
phenylalanine
F
proline
P
serine
S
threonine or thymine
T
tryptophan
W
tyrosine
Y
valine
V
uracil
U
water
O
other
X
A preliminary classification used by PDB to indicate
that the chemistry of this component while described
as clearly as possible is still ambiguous. Software
tools may not be able to process this component
definition.
A serial number used by PDB in the FORMUL record.
3
The net integer charge assigned to this component. This is the
formal charge assignment normally found in chemical diagrams.
This data item identifies the source of the ideal coordinates in the
component definition.
This data item identifies if ideal coordinates are missing in this definition.
Date component was added to database.
This data item identifies the PDB database code from which the heavy
atom model coordinates were obtained.
This data item provides additional details about the model coordinates
in the component definition.
This data item identifies if model coordinates are missing in this definition.
For nonstandard components a text description
of modification of the parent component.
ATP
Date component was last modified.
This data item identifies the deposition site that processed
this chemical component defintion.
This data item holds the current release status for the component.
Identifies the attribute id in category chem_comp of the component that
has replaced this component.
q11
tvx
Identifies the attribute id's in category chem_comp of the components
which have been replaced by this component.
Multiple id codes should be separated by commas.
q11
tvx,atv
The list of subcomponents contained in this component.
TSM DPH HIS CHF EMR
Synonym list for the component.
ATP
A preliminary classification used by PDB.
For standard polymer components, the three-letter code for
the component. If there is not a standard three-letter code
for this component, or if this is a non-polymer
component, the three-letter code should be given as 'UNK'.
This code may be preceded by a '+' character to indicate
that the component is a modification of a standard
component.
alanine
ALA
arginine
ARG
asparagine
ASN
aspartic acid
ASP
ambiguous asparagine/aspartic acid
ASX
cysteine
CYS
glutamine
GLN
glutamic acid
GLU
glycine
GLY
ambiguous glutamine/glutamic acid
GLX
histidine
HIS
isoleucine
ILE
leucine
LEU
lysine
LYS
methionine
MET
phenylalanine
PHE
proline
PRO
serine
SER
threonine
THR
tryptophan
TRP
tyrosine
TRY
valine
VAL
1-methyladenosine
1MA
5-methylcytosine
5MC
2(prime)-O-methylcytodine
OMC
1-methylguanosine
1MG
N(2)-methylguanosine
2MG
N(2)-dimethylguanosine
M2G
7-methylguanosine
7MG
2(prime)-O-methylguanosine
0MG
dihydrouridine
H2U
ribosylthymidine
5MU
pseudouridine
PSU
acetic acid
ACE
formic acid
FOR
water
HOH
other
UNK
For standard polymer components, the type of the monomer.
Note that monomers that will form polymers are of three types:
linking monomers, monomers with some type of N-terminal (or 5')
cap and monomers with some type of C-terminal (or 3') cap.
The value of attribute id in category chem_comp must uniquely identify each item in
the CHEM_COMP list.
For protein polymer entities, this is the three-letter code for
the amino acid.
For nucleic acid polymer entities, this is the one-letter code
for the base.
ALA
VAL
DG
C
Data items in the CHEM_COMP_ANGLE category record details about
angles in a chemical component. Angles are designated by three
atoms, with the second atom forming the vertex of the angle.
Target values may be specified as angles in degrees, as a
distance between the first and third atoms, or both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_angleCategory>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CA" atom_id_3="C">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CA" atom_id_3="N">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CG" atom_id_3="CD1">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CG" atom_id_3="CD2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CD1" atom_id_2="CG" atom_id_3="CD2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CG" atom_id_2="CD1" atom_id_3="CE1">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CD1" atom_id_2="CE1" atom_id_3="CZ">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CE1" atom_id_2="CZ" atom_id_3="CE2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CZ" atom_id_2="CE2" atom_id_3="CD2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="phe" atom_id_1="CG" atom_id_2="CD2" atom_id_3="CE2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CB" atom_id_2="CA" atom_id_3="C">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CB" atom_id_2="CA" atom_id_3="N">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG1">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
<mmCIF:chem_comp_angle comp_id="val" atom_id_1="CG1" atom_id_2="CB" atom_id_3="CG2">
<mmCIF:value_angle>xxx.xx</mmCIF:value_angle>
<mmCIF:value_dist>x.xx</mmCIF:value_dist>
</mmCIF:chem_comp_angle>
</mmCIF:chem_comp_angleCategory>
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed in degrees.
The standard uncertainty (estimated standard deviation)
of attribute value_angle in category chem_comp_angle.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed as the distance
between the atoms specified by attribute atom_id_1 in category chem_comp_angle and
attribute atom_id_3 in category chem_comp_angle.
The standard uncertainty (estimated standard deviation)
of attribute value_dist in category chem_comp_angle.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The ID of the first of the three atoms that define the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the second of the three atoms that define the angle.
The second atom is taken to be the apex of the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the third of the three atoms that define the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
Data items in the CHEM_COMP_ATOM category record details about
the atoms in a chemical component. Specifying the atomic
coordinates for the components in this category is an
alternative to specifying the structure of the component
via bonds, angles, planes etc. in the appropriate
CHEM_COMP subcategories.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_atomCategory>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="N">
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>1.20134</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.84658</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CA">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.00000</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.00000</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="C">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-1.25029</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.88107</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="O">
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-2.18525</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.66029</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>-0.78409</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CB">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.00662</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-1.03603</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>1.11081</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CG">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.03254</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-0.49711</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>2.50951</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CD1">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-1.15813</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-0.12084</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>3.13467</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CE1">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-1.15720</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.38038</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>4.42732</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CZ">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.05385</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.51332</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>5.11032</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CE2">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>1.26137</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.11613</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>4.50975</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="phe" atom_id="CD2">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>1.23668</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-0.38351</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>3.20288</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="N">
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>1.20134</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.84658</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="CA">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.00000</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.00000</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="C">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-1.25029</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.88107</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.00000</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="O">
<mmCIF:type_symbol>O</mmCIF:type_symbol>
<mmCIF:substruct_code>main</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-2.18525</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>0.66029</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>-0.78409</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="CB">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>0.05260</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-0.99339</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>1.17429</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="CG1">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-0.13288</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-0.31545</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>2.52668</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
<mmCIF:chem_comp_atom comp_id="val" atom_id="CG2">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:substruct_code>side</mmCIF:substruct_code>
<mmCIF:model_Cartn_x>-0.94265</mmCIF:model_Cartn_x>
<mmCIF:model_Cartn_y>-2.12930</mmCIF:model_Cartn_y>
<mmCIF:model_Cartn_z>0.99811</mmCIF:model_Cartn_z>
</mmCIF:chem_comp_atom>
</mmCIF:chem_comp_atomCategory>
An alternative identifier for the atom. This data item would be
used in cases where alternative nomenclatures exist for labelling
atoms in a group.
The net integer charge assigned to this atom. This is the
formal charge assignment normally found in chemical diagrams.
for an ammonium nitrogen
1
for a chloride ion
-1
The x component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, not to atom sites in the ATOM_SITE
list.
The standard uncertainty (estimated standard deviation)
of attribute model_Cartn_x in category chem_comp_atom.
The y component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, not to atom sites in the ATOM_SITE
list.
The standard uncertainty (estimated standard deviation)
of attribute model_Cartn_y in category chem_comp_atom.
The z component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, not to atom sites in the ATOM_SITE
list.
The standard uncertainty (estimated standard deviation)
of attribute model_Cartn_z in category chem_comp_atom.
The partial charge assigned to this atom.
Atom name alignment offset in PDB atom field.
An alternative identifier for the atom. This data item would be
used in cases where alternative nomenclatures exist for labelling
atoms in a group.
An alternative identifier for the atom. This data item would be
used in cases where alternative nomenclatures exist for labelling
atoms in a group.
A flag indicating an aromatic atom.
The atom identifier in the subcomponent where a
larger component has been divided subcomponents.
CB
CA
CG
The component identifier for the subcomponent where a
larger component has been divided subcomponents.
HIS
PRO
A flag indicating a leaving atom.
An alternative x component of the coordinates for this atom in this
component specified as orthogonal angstroms.
An alternative y component of the coordinates for this atom in this
component specified as orthogonal angstroms.
An alternative z component of the coordinates for this atom in this
component specified as orthogonal angstroms.
Ordinal index for the component atom list.
The chiral configuration of the atom that is a chiral center.
This data item assigns the atom to a substructure of the
component, if appropriate.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute atom_id in category chem_comp_atom must uniquely identify
each atom in each monomer in the CHEM_COMP_ATOM list.
The atom identifiers need not be unique over all atoms in the
data block; they need only be unique for each atom in a
component.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the CHEM_COMP_BOND category record details about
the bonds between atoms in a chemical component. Target values
may be specified as bond orders, as a distance between the two
atoms, or both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_bondCategory>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="N" atom_id_2="CA">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CA" atom_id_2="C">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="C" atom_id_2="O">
<mmCIF:value_order>doub</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CB" atom_id_2="CA">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CB" atom_id_2="CG">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CG" atom_id_2="CD1">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CD1" atom_id_2="CE1">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CE1" atom_id_2="CZ">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CZ" atom_id_2="CE2">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CE2" atom_id_2="CD2">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="phe" atom_id_1="CD2" atom_id_2="CG">
<mmCIF:value_order>arom</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="N" atom_id_2="CA">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="CA" atom_id_2="C">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="C" atom_id_2="O">
<mmCIF:value_order>doub</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CA">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CG1">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
<mmCIF:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CG2">
<mmCIF:value_order>sing</mmCIF:value_order>
</mmCIF:chem_comp_bond>
</mmCIF:chem_comp_bondCategory>
A flag indicating an aromatic bond.
Ordinal index for the component bond list.
Stereochemical configuration across a double bond.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a
distance.
The standard uncertainty (estimated standard deviation)
of attribute value_dist in category chem_comp_bond.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a bond
order.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The ID of the first of the two atoms that define the bond.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the second of the two atoms that define the bond.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
Data items in the CHEM_COMP_CHIR category provide details about
the chiral centres in a chemical component. The atoms bonded
to the chiral atom are specified in the CHEM_COMP_CHIR_ATOM
category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_chirCategory>
<mmCIF:chem_comp_chir comp_id="phe" id="phe1">
<mmCIF:atom_id>CA</mmCIF:atom_id>
</mmCIF:chem_comp_chir>
<mmCIF:chem_comp_chir comp_id="val" id="val1">
<mmCIF:atom_id>CA</mmCIF:atom_id>
</mmCIF:chem_comp_chir>
</mmCIF:chem_comp_chirCategory>
The chiral configuration of the atom that is a chiral centre.
The ID of the atom that is a chiral centre.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The total number of atoms bonded to the atom specified by
attribute atom_id in category chem_comp_chir.
The number of non-hydrogen atoms bonded to the atom specified by
attribute atom_id in category chem_comp_chir.
A flag to indicate whether a chiral volume should match the
standard value in both magnitude and sign, or in magnitude only.
The chiral volume, V~c~, for chiral centres that involve a chiral
atom bonded to three non-hydrogen atoms and one hydrogen atom.
V~c~ = V1 * (V2 X V3)
V1 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the first atom in the
CHEM_COMP_CHIR_ATOM list
V2 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the second atom in the
CHEM_COMP_CHIR_ATOM list
V3 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the third atom in the
CHEM_COMP_CHIR_ATOM list
* = the vector dot product
X = the vector cross product
The standard uncertainty (estimated standard deviation)
of attribute volume_three in category chem_comp_chir.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_chir must uniquely identify a record
in the CHEM_COMP_CHIR list.
Data items in the CHEM_COMP_CHIR_ATOM category enumerate the
atoms bonded to a chiral atom within a chemical component.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_chir_atomCategory>
<mmCIF:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="N"></mmCIF:chem_comp_chir_atom>
<mmCIF:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="C"></mmCIF:chem_comp_chir_atom>
<mmCIF:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="CB"></mmCIF:chem_comp_chir_atom>
<mmCIF:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="N"></mmCIF:chem_comp_chir_atom>
<mmCIF:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="C"></mmCIF:chem_comp_chir_atom>
<mmCIF:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="CB"></mmCIF:chem_comp_chir_atom>
</mmCIF:chem_comp_chir_atomCategory>
The standard uncertainty (estimated standard deviation)
of the position of this atom from the plane defined by
all of the atoms in the plane.
This data item is a pointer to attribute id in category chem_comp_chir in the
CHEM_COMP_CHIR category.
The ID of an atom bonded to the chiral atom.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the
CHEM_COMP category.
Data items in the CHEM_COMP_LINK category give details about
the links between chemical components.
A description of special aspects of a link between
chemical components in the structure.
The type of the first of the two components joined by the
link.
This data item is a pointer to attribute type in category chem_comp in the CHEM_COMP
category.
The type of the second of the two components joined by the
link.
This data item is a pointer to attribute type in category chem_comp in the CHEM_COMP
category.
This data item is a pointer to attribute id in category chem_link in the
CHEM_LINK category.
Data items in the CHEM_COMP_PLANE category provide identifiers
for the planes in a chemical component. The atoms in the plane
are specified in the CHEM_COMP_PLANE_ATOM category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_planeCategory>
<mmCIF:chem_comp_plane comp_id="phe" id="phe1"></mmCIF:chem_comp_plane>
</mmCIF:chem_comp_planeCategory>
The total number of atoms in the plane.
The number of non-hydrogen atoms in the plane.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_plane must uniquely identify a record
in the CHEM_COMP_PLANE list.
Data items in the CHEM_COMP_PLANE_ATOM category enumerate the
atoms in a plane within a chemical component.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_plane_atomCategory>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CB"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CG"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CD1"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CE1"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CZ"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CE2"></mmCIF:chem_comp_plane_atom>
<mmCIF:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CD2"></mmCIF:chem_comp_plane_atom>
</mmCIF:chem_comp_plane_atomCategory>
This data item is the standard deviation of the
out-of-plane distance for this atom.
This data item is a pointer to attribute id in category chem_comp_plane in the
CHEM_COMP_PLANE category.
The ID of an atom involved in the plane.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
Data items in the CHEM_COMP_TOR category record details about
the torsion angles in a chemical component. As torsion angles
can have more than one target value, the target values are
specified in the CHEM_COMP_TOR_VALUE category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_torCategory>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_chi1">
<mmCIF:atom_id_1>N</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CA</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CB</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CG</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_chi2">
<mmCIF:atom_id_1>CA</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CB</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CG</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CD1</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_ring1">
<mmCIF:atom_id_1>CB</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CG</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CD1</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CE1</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_ring2">
<mmCIF:atom_id_1>CB</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CG</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CD2</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CE2</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_ring3">
<mmCIF:atom_id_1>CG</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CD1</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CE1</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CZ</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_ring4">
<mmCIF:atom_id_1>CD1</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CE1</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CZ</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CE2</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
<mmCIF:chem_comp_tor comp_id="phe" id="phe_ring5">
<mmCIF:atom_id_1>CE1</mmCIF:atom_id_1>
<mmCIF:atom_id_2>CZ</mmCIF:atom_id_2>
<mmCIF:atom_id_3>CE2</mmCIF:atom_id_3>
<mmCIF:atom_id_4>CD2</mmCIF:atom_id_4>
</mmCIF:chem_comp_tor>
</mmCIF:chem_comp_torCategory>
The ID of the first of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the second of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the third of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The ID of the fourth of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_tor must uniquely identify a
record in the CHEM_COMP_TOR list.
Data items in the CHEM_COMP_TOR_VALUE category record details
about the target values for the torsion angles enumerated in the
CHEM_COMP_TOR list. Target values may be specified as angles
in degrees, as a distance between the first and fourth atoms, or
both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:chem_comp_tor_valueCategory>
<mmCIF:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<mmCIF:angle>-60.0</mmCIF:angle>
<mmCIF:dist>2.88</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<mmCIF:angle>180.0</mmCIF:angle>
<mmCIF:dist>3.72</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<mmCIF:angle>60.0</mmCIF:angle>
<mmCIF:dist>2.88</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_chi2" comp_id="phe">
<mmCIF:angle>90.0</mmCIF:angle>
<mmCIF:dist>3.34</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_chi2" comp_id="phe">
<mmCIF:angle>-90.0</mmCIF:angle>
<mmCIF:dist>3.34</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_ring1" comp_id="phe">
<mmCIF:angle>180.0</mmCIF:angle>
<mmCIF:dist>3.75</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_ring2" comp_id="phe">
<mmCIF:angle>180.0</mmCIF:angle>
<mmCIF:dist>3.75</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_ring3" comp_id="phe">
<mmCIF:angle>0.0</mmCIF:angle>
<mmCIF:dist>2.80</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_ring4" comp_id="phe">
<mmCIF:angle>0.0</mmCIF:angle>
<mmCIF:dist>2.80</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
<mmCIF:chem_comp_tor_value tor_id="phe_ring5" comp_id="phe">
<mmCIF:angle>0.0</mmCIF:angle>
<mmCIF:dist>2.80</mmCIF:dist>
</mmCIF:chem_comp_tor_value>
</mmCIF:chem_comp_tor_valueCategory>
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed in
degrees.
The standard uncertainty (estimated standard deviation)
of attribute angle in category chem_comp_tor_value.
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed as
the distance between the atoms specified by
_chem_comp_tor.atom_id_1 and _chem_comp_tor.atom_id_4 in the
referenced record in the CHEM_COMP_TOR list. Note that the
torsion angle cannot be fully specified by a distance (for
instance, a torsion angle of -60 degree will yield the same
distance as a 60 degree angle). However, the distance
specification can be useful for refinement in situations
in which the angle is already close to the desired value.
The standard uncertainty (estimated standard deviation)
of attribute dist in category chem_comp_tor_value.
This data item is a pointer to attribute id in category chem_comp_tor in the
CHEM_COMP_TOR category.
This data item is a pointer to attribute comp_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
Data items in the CHEM_LINK category give details about
the links between chemical components.
A description of special aspects of a link between
chemical components in the structure.
The value of attribute id in category chem_link must uniquely identify each
item in the CHEM_LINK list.
peptide
oligosaccharide 1,4
DNA
Data items in the CHEM_LINK_ANGLE category record details
about angles in a link between chemical components.
Example 1 - Engh & Huber parameters [Acta Cryst. (1991), A47,
392-400] as interpreted by J. P. Priestle (1995). Consistent
Stereochemical Dictionaries for Refinement and Model
Building. CCP4 Daresbury Study Weekend,
DL-CONF-95-001, ISSN 1358-6254. Warrington: Daresbury
Laboratory.
<mmCIF:chem_link_angleCategory>
<mmCIF:chem_link_angle link_id="PEPTIDE" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<mmCIF:value_angle>111.2</mmCIF:value_angle>
<mmCIF:value_angle_esd>2.8</mmCIF:value_angle_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
<mmCIF:atom_3_comp_id>1</mmCIF:atom_3_comp_id>
</mmCIF:chem_link_angle>
<mmCIF:chem_link_angle link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<mmCIF:value_angle>120.8</mmCIF:value_angle>
<mmCIF:value_angle_esd>1.7</mmCIF:value_angle_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
<mmCIF:atom_3_comp_id>1</mmCIF:atom_3_comp_id>
</mmCIF:chem_link_angle>
<mmCIF:chem_link_angle link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C" atom_id_3="N">
<mmCIF:value_angle>116.2</mmCIF:value_angle>
<mmCIF:value_angle_esd>2.0</mmCIF:value_angle_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
<mmCIF:atom_3_comp_id>2</mmCIF:atom_3_comp_id>
</mmCIF:chem_link_angle>
<mmCIF:chem_link_angle link_id="PEPTIDE" atom_id_1="O" atom_id_2="C" atom_id_3="N">
<mmCIF:value_angle>123.0</mmCIF:value_angle>
<mmCIF:value_angle_esd>1.6</mmCIF:value_angle_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
<mmCIF:atom_3_comp_id>2</mmCIF:atom_3_comp_id>
</mmCIF:chem_link_angle>
<mmCIF:chem_link_angle link_id="PEPTIDE" atom_id_1="C" atom_id_2="N" atom_id_3="CA">
<mmCIF:value_angle>121.7</mmCIF:value_angle>
<mmCIF:value_angle_esd>1.8</mmCIF:value_angle_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>2</mmCIF:atom_2_comp_id>
<mmCIF:atom_3_comp_id>2</mmCIF:atom_3_comp_id>
</mmCIF:chem_link_angle>
</mmCIF:chem_link_angleCategory>
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 2 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 3 is found in the first
or the second of the two components connected by the link.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed in degrees.
The standard uncertainty (estimated standard deviation)
of attribute value_angle in category chem_link_angle.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed as the distance
between the atoms specified by attribute atom_id_1 in category chem_comp_angle and
attribute atom_id_3 in category chem_comp_angle.
The standard uncertainty (estimated standard deviation)
of attribute value_dist in category chem_comp_angle.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The ID of the first of the three atoms that define the angle.
An atom with this ID must exist in the component of the type
specified by attribute type_comp_1 in category chem_comp_link (or
attribute type_comp_2 in category chem_comp_link where the appropriate data item
is indicated by the value of attribute atom_1_comp_id) in category chem_comp_angle.
The ID of the second of the three atoms that define the angle.
The second atom is taken to be the apex of the angle.
An atom with this ID must exist in the component of the type
specified by attribute type_comp_1 in category chem_comp_link (or
attribute type_comp_2 in category chem_comp_link where the appropriate data item
is indicated by the value of attribute atom_2_comp_id) in category chem_comp_angle.
The ID of the third of the three atoms that define the angle.
An atom with this ID must exist in the component of the type
specified by attribute type_comp_1 in category chem_comp_link (or
attribute type_comp_2 in category chem_comp_link where the appropriate data item
is indicated by the value of attribute atom_3_comp_id) in category chem_comp_angle.
Data items in the CHEM_LINK_BOND category record details about
bonds in a link between components in the chemical structure.
Example 1 - Engh & Huber parameters [Acta Cryst. (1991), A47,
392-400] as interpreted by J. P. Priestle (1995). Consistent
Stereochemical Dictionaries for Refinement and Model
Building. CCP4 Daresbury Study Weekend,
DL-CONF-95-001, ISSN 1358-6254. Warrington: Daresbury
Laboratory.
<mmCIF:chem_link_bondCategory>
<mmCIF:chem_link_bond link_id="PEPTIDE" atom_id_1="N" atom_id_2="CA">
<mmCIF:value_dist>1.458</mmCIF:value_dist>
<mmCIF:value_dist_esd>0.019</mmCIF:value_dist_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
</mmCIF:chem_link_bond>
<mmCIF:chem_link_bond link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C">
<mmCIF:value_dist>1.525</mmCIF:value_dist>
<mmCIF:value_dist_esd>0.021</mmCIF:value_dist_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
</mmCIF:chem_link_bond>
<mmCIF:chem_link_bond link_id="PEPTIDE" atom_id_1="C" atom_id_2="N">
<mmCIF:value_dist>1.329</mmCIF:value_dist>
<mmCIF:value_dist_esd>0.014</mmCIF:value_dist_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>2</mmCIF:atom_2_comp_id>
</mmCIF:chem_link_bond>
<mmCIF:chem_link_bond link_id="PEPTIDE" atom_id_1="C" atom_id_2="O">
<mmCIF:value_dist>1.231</mmCIF:value_dist>
<mmCIF:value_dist_esd>0.020</mmCIF:value_dist_esd>
<mmCIF:atom_1_comp_id>1</mmCIF:atom_1_comp_id>
<mmCIF:atom_2_comp_id>1</mmCIF:atom_2_comp_id>
</mmCIF:chem_link_bond>
</mmCIF:chem_link_bondCategory>
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 2 is found in the first
or the second of the two chemical components connected by
the link.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a
distance.
The standard uncertainty (estimated standard deviation)
of attribute value_dist in category chem_link_bond.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a bond
order.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The ID of the first of the two atoms that define the bond.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the
linkage sense.
The ID of the second of the two atoms that define the bond.
As this data item does not point to a specific atom in a
specific component, it is not a child in the linkage sense.
Data items in the CHEM_LINK_CHIR category provide details about
the chiral centres in a link between two chemical components.
The atoms bonded to the chiral atom are specified in the
CHEM_LINK_CHIR_ATOM category.
This data item indicates whether the chiral atom is found in the
first or the second of the two components connected by the
link.
The chiral configuration of the atom that is a chiral centre.
The ID of the atom that is a chiral centre.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The total number of atoms bonded to the atom specified by
attribute atom_id in category chem_link_chir.
The number of non-hydrogen atoms bonded to the atom specified by
attribute atom_id in category chem_link_chir.
A flag to indicate whether a chiral volume should match the
standard value in both magnitude and sign, or in magnitude only.
The chiral volume, V(c), for chiral centres that involve a chiral
atom bonded to three non-hydrogen atoms and one hydrogen atom.
V~c~ = V1 * (V2 X V3)
V1 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the first atom in the
CHEM_LINK_CHIR_ATOM list
V2 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the second atom in the
CHEM_LINK_CHIR_ATOM list
V3 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the third atom in the
CHEM_LINK_CHIR_ATOM list
* = the vector dot product
X = the vector cross product
The standard uncertainty (estimated standard deviation)
of attribute volume_three in category chem_link_chir.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_chir must uniquely identify a record
in the CHEM_LINK_CHIR list.
Data items in the CHEM_LINK_CHIR_ATOM category enumerate the
atoms bonded to a chiral atom in a link between two
chemical components.
This data item indicates whether the atom bonded to a chiral
atom is found in the first or the second of the two components
connected by the link.
The standard uncertainty (estimated standard deviation)
of the position of this atom from the plane defined by
all of the atoms in the plane.
This data item is a pointer to attribute id in category chem_link_chir in the
CHEM_LINK_CHIR category.
The ID of an atom bonded to the chiral atom.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
Data items in the CHEM_LINK_PLANE category provide identifiers
for the planes in a link between two chemical components.
The atoms in the plane are specified in the CHEM_LINK_PLANE_ATOM
category.
The total number of atoms in the plane.
The number of non-hydrogen atoms in the plane.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_plane must uniquely identify a record
in the CHEM_LINK_PLANE list.
Data items in the CHEM_LINK_PLANE_ATOM category enumerate the
atoms in a plane in a link between two chemical components.
This data item indicates whether the atom in a plane is found in
the first or the second of the two components connected by the
link.
This data item is a pointer to attribute id in category chem_link_plane in the
CHEM_LINK_PLANE category.
The ID of an atom involved in the plane.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
Data items in the CHEM_LINK_TOR category record details about
the torsion angles in a link between two chemical components.
As torsion angles can have more than one target value, the
target values are specified in the CHEM_LINK_TOR_VALUE category.
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 2 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 3 is found in the first
or the second of the two components connected by the link.
This data item indicates whether atom 4 is found in the first
or the second of the two components connected by the link.
The ID of the first of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The ID of the second of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The ID of the third of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The ID of the fourth of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_tor must uniquely identify a
record in the CHEM_LINK_TOR list.
Data items in the CHEM_LINK_TOR_VALUE category record details
about the target values for the torsion angles enumerated in the
CHEM_LINK_TOR list. Target values may be specified as angles
in degrees, as a distance between the first and fourth atoms, or
both.
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed in
degrees.
The standard uncertainty (estimated standard deviation)
of attribute angle in category chem_link_tor_value.
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed as
the distance between the atoms specified by
_chem_link_tor.atom_id_1 and _chem_link_tor.atom_id_4 in the
referenced record in the CHEM_LINK_TOR list. Note that the
torsion angle cannot be fully specified by a distance (for
instance, a torsion angle of -60 degree will yield the same
distance as a 60 degree angle). However, the distance
specification can be useful for refinement in situations in
which the angle is already close to the desired value.
The standard uncertainty (estimated standard deviation)
of attribute dist in category chem_link_tor_value.
This data item is a pointer to attribute id in category chem_link_tor in the
CHEM_LINK_TOR category.
Data items in the CHEMICAL category would not in general be
used in a macromolecular CIF. See instead the ENTITY data
items.
Data items in the CHEMICAL category record details about the
composition and chemical properties of the compounds. The
formula data items must agree with those that specify the
density, unit-cell and Z values.
Example 1 - based on data set 9597gaus of Alyea, Ferguson & Kannan
[Acta Cryst. (1996), C52, 765-767].
<mmCIF:chemicalCategory>
<mmCIF:chemical entry_id="9597gaus">
<mmCIF:name_systematic>trans-bis(tricyclohexylphosphine)tetracarbonylmolybdenum(0)</mmCIF:name_systematic>
</mmCIF:chemical>
</mmCIF:chemicalCategory>
Necessary conditions for the assignment of
attribute absolute_configuration in category chemical are given by H. D. Flack and
G. Bernardinelli (1999, 2000).
Ref: Flack, H. D. & Bernardinelli, G. (1999). Acta Cryst. A55,
908-915. (http://www.iucr.org/paper?sh0129)
Flack, H. D. & Bernardinelli, G. (2000). J. Appl. Cryst.
33, 1143-1148. (http://www.iucr.org/paper?ks0021)
Description of the source of the compound under study, or of the
parent molecule if a simple derivative is studied. This includes
the place of discovery for minerals or the actual source of a
natural product.
From Norilsk (USSR)
Extracted from the bark of Cinchona Naturalis
The temperature in kelvins at which the crystalline solid changes
to a liquid.
A temperature in kelvins above
which the melting point (the temperature at which the
crystalline solid changes to a liquid) lies.
_chemical.melting_point_gt and _chemical.melting_point_lt
allow a range of temperatures to be given.
attribute melting_point in category chemical should always be used in preference
to these two items whenever possible.
A temperature in kelvins below which the melting point (the
temperature at which the crystalline solid changes to a liquid)
lies. _chemical.melting_point_gt and _chemical.melting_point_lt
allow a range of temperatures to be given.
attribute melting_point in category chemical should always be used in preference
to these two items whenever possible.
Trivial name by which the compound is commonly known.
1-bromoestradiol
Mineral name accepted by the International Mineralogical
Association. Use only for natural minerals. See also
attribute compound_source in category chemical.
chalcopyrite
Commonly used structure-type name. Usually only applied to
minerals or inorganic compounds.
perovskite
sphalerite
A15
IUPAC or Chemical Abstracts full name of the compound.
1-bromoestra-1,3,5(10)-triene-3,17\b-diol
The optical rotation in solution of the compound is
specified in the following format:
'[\a]^TEMP^~WAVE~ = SORT (c = CONC, SOLV)'
where:
TEMP is the temperature of the measurement in degrees
Celsius,
WAVE is an indication of the wavelength of the light
used for the measurement,
CONC is the concentration of the solution given as the
mass of the substance in g in 100 ml of solution,
SORT is the signed value (preceded by a + or a - sign)
of 100.\a/(l.c), where \a is the signed optical
rotation in degrees measured in a cell of length l in
dm and c is the value of CONC as defined above, and
SOLV is the chemical formula of the solvent.
[\a]^25^~D~ = +108 (c = 3.42, CHCl~3~)
A free-text description of the biological properties of the
material.
diverse biological activities including use as a
laxative and strong antibacterial activity against
S. aureus and weak activity against
cyclooxygenase-1 (COX-1)
antibiotic activity against Bacillus subtilis
(ATCC 6051) but no significant activity against
Candida albicans (ATCC 14053), Aspergillus flavus
(NRRL 6541) and Fusarium verticillioides (NRRL
25457)
weakly potent lipoxygenase nonredox inhibitor
no influenza A virus sialidase inhibitory and
plaque reduction activities
low toxicity against Drosophila melanogaster
A free-text description of the physical properties of the material.
air-sensitive
moisture-sensitive
hygroscopic
deliquescent
oxygen-sensitive
photo-sensitive
pyrophoric
semiconductor
ferromagnetic at low temperature
paramagnetic and thermochromic
The temperature in kelvins at which the solid decomposes.
350
The estimated standard deviation of
attribute temperature_decomposition in category chemical.
A temperature in kelvins above which the solid is known to
decompose. attribute temperature_decomposition_gt in category chemical and
attribute temperature_decomposition_lt in category chemical allow
a range of temperatures to be given.
attribute temperature_decomposition in category chemical should always be used in
preference to these two items whenever possible.
350
A temperature in kelvins below which the solid is known to
decompose. attribute temperature_decomposition_gt in category chemical and
attribute temperature_decomposition_lt in category chemical allow
a range of temperatures to be given.
attribute temperature_decomposition in category chemical should always be used in
preference to these two items whenever possible.
350
The temperature in kelvins at which the solid sublimes.
350
The estimated standard deviation of
attribute temperature_sublimation in category chemical.
A temperature in kelvins above which the solid is known to
sublime. attribute temperature_sublimation_gt in category chemical and
attribute temperature_sublimation_lt in category chemical allow a
range of temperatures to be given.
attribute temperature_sublimation in category chemical should always be used in
preference to these two items whenever possible.
350
A temperature in kelvins below which the solid is known to
sublime. attribute temperature_sublimation_gt in category chemical and
attribute temperature_sublimation_lt in category chemical allow a
range of temperatures to be given.
attribute temperature_sublimation in category chemical should always be used in
preference to these two items whenever possible.
350
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CHEMICAL_CONN_ATOM category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND
categories record details about the two-dimensional (2D)
chemical structure of the molecular species. They allow
a 2D chemical diagram to be reconstructed for use in a
publication or in a database search for structural and
substructural relationships.
The CHEMICAL_CONN_ATOM data items provide information about the
chemical properties of the atoms in the structure. In cases
where crystallographic and molecular symmetry elements coincide,
they must also contain symmetry-generated atoms, so that the
CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND data items will always
describe a complete chemical entity.
Example 1 - based on data set DPTD of Yamin, Suwandi, Fun, Sivakumar &
bin Shawkataly [Acta Cryst. (1996), C52, 951-953].
<mmCIF:chemical_conn_atomCategory>
<mmCIF:chemical_conn_atom number="1">
<mmCIF:type_symbol>S</mmCIF:type_symbol>
<mmCIF:display_x>.39</mmCIF:display_x>
<mmCIF:display_y>.81</mmCIF:display_y>
<mmCIF:NCA>1</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="2">
<mmCIF:type_symbol>S</mmCIF:type_symbol>
<mmCIF:display_x>.39</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="3">
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:display_x>.14</mmCIF:display_x>
<mmCIF:display_y>.88</mmCIF:display_y>
<mmCIF:NCA>3</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="4">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.33</mmCIF:display_x>
<mmCIF:display_y>.88</mmCIF:display_y>
<mmCIF:NCA>3</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="5">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.11</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="6">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.03</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="7">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.03</mmCIF:display_x>
<mmCIF:display_y>.80</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="8">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.11</mmCIF:display_x>
<mmCIF:display_y>.80</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="9">
<mmCIF:type_symbol>S</mmCIF:type_symbol>
<mmCIF:display_x>.54</mmCIF:display_x>
<mmCIF:display_y>.81</mmCIF:display_y>
<mmCIF:NCA>1</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="10">
<mmCIF:type_symbol>S</mmCIF:type_symbol>
<mmCIF:display_x>.54</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="11">
<mmCIF:type_symbol>N</mmCIF:type_symbol>
<mmCIF:display_x>.80</mmCIF:display_x>
<mmCIF:display_y>.88</mmCIF:display_y>
<mmCIF:NCA>3</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="12">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.60</mmCIF:display_x>
<mmCIF:display_y>.88</mmCIF:display_y>
<mmCIF:NCA>3</mmCIF:NCA>
<mmCIF:NH>0</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="13">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.84</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="14">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.91</mmCIF:display_x>
<mmCIF:display_y>.96</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="15">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.91</mmCIF:display_x>
<mmCIF:display_y>.80</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
<mmCIF:chemical_conn_atom number="16">
<mmCIF:type_symbol>C</mmCIF:type_symbol>
<mmCIF:display_x>.84</mmCIF:display_x>
<mmCIF:display_y>.80</mmCIF:display_y>
<mmCIF:NCA>2</mmCIF:NCA>
<mmCIF:NH>2</mmCIF:NH>
</mmCIF:chemical_conn_atom>
</mmCIF:chemical_conn_atomCategory>
The number of connected atoms excluding terminal hydrogen atoms.
The total number of hydrogen atoms attached to this atom,
regardless of whether they are included in the refinement or
the ATOM_SITE list. This number is the same as
attribute attached_hydrogens in category atom_site only if none of the hydrogen
atoms appear in the ATOM_SITE list.
The net integer charge assigned to this atom. This is the
formal charge assignment normally found in chemical diagrams.
for an ammonium nitrogen
1
for a chloride ion
-1
The 2D Cartesian x coordinate of the position of this atom in a
recognizable chemical diagram. The coordinate origin is at the
lower left corner, the x axis is horizontal and the y axis
is vertical. The coordinates must lie in the range 0.0 to 1.0.
These coordinates can be obtained from projections of a suitable
uncluttered view of the molecular structure.
The 2D Cartesian y coordinate of the position of this atom in a
recognizable chemical diagram. The coordinate origin is at the
lower left corner, the x axis is horizontal and the y axis
is vertical. The coordinates must lie in the range 0.0 to 1.0.
These coordinates can be obtained from projections of a suitable
uncluttered view of the molecular structure.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
The chemical sequence number to be associated with this atom.
Within an ATOM_SITE list, this number must match one of
the attribute chemical_conn_number in category atom_site values.
Data items in the CHEMICAL_CONN_BOND category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND
categories record details about the two-dimensional (2D)
chemical structure of the molecular species. They allow a
2D chemical diagram to be reconstructed for use in a
publication or in a database search for structural and
substructural relationships.
The CHEMICAL_CONN_BOND data items specify the connections
between the atoms in the CHEMICAL_CONN_ATOM list and the nature
of the chemical bond between these atoms.
Example 1 - based on data set DPTD of Yamin, Suwandi, Fun, Sivakumar &
bin Shawkataly [Acta Cryst. (1996), C52, 951-953].
<mmCIF:chemical_conn_bondCategory>
<mmCIF:chemical_conn_bond atom_1="4" atom_2="1">
<mmCIF:type>doub</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="4" atom_2="3">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="4" atom_2="2">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="5" atom_2="3">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="6" atom_2="5">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="7" atom_2="6">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="8" atom_2="7">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="8" atom_2="3">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="10" atom_2="2">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="12" atom_2="9">
<mmCIF:type>doub</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="12" atom_2="11">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="12" atom_2="10">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="13" atom_2="11">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="14" atom_2="13">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="15" atom_2="14">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="16" atom_2="15">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="16" atom_2="11">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="17" atom_2="5">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="18" atom_2="5">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="19" atom_2="6">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="20" atom_2="6">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="21" atom_2="7">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="22" atom_2="7">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="23" atom_2="8">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="24" atom_2="8">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="25" atom_2="13">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="26" atom_2="13">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="27" atom_2="14">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="28" atom_2="14">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="29" atom_2="15">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="30" atom_2="15">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="31" atom_2="16">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
<mmCIF:chemical_conn_bond atom_1="32" atom_2="16">
<mmCIF:type>sing</mmCIF:type>
</mmCIF:chemical_conn_bond>
</mmCIF:chemical_conn_bondCategory>
The chemical bond type associated with the connection between
the two sites attribute atom_1 in category chemical_conn_bond and
attribute atom_2 in category chemical_conn_bond.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
Data items in the CHEMICAL_FORMULA category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_FORMULA category specify the
composition and chemical properties of the compound. The formula
data items must agree with those that specify the density,
unit-cell and Z values.
The following rules apply to the construction of the data items
_chemical_formula.analytical, _chemical_formula.structural and
attribute sum in category chemical_formula. For the data item
attribute moiety in category chemical_formula the formula construction is broken up
into residues or moieties, i.e. groups of atoms that form a
molecular unit or molecular ion. The rules given below apply
within each moiety but different requirements apply to the way
that moieties are connected (see attribute moiety).
in category chemical_formula
(1) Only recognized element symbols may be used.
(2) Each element symbol is followed by a 'count' number. A count
of '1' may be omitted.
(3) A space or parenthesis must separate each cluster of (element
symbol + count).
(4) Where a group of elements is enclosed in parentheses, the
multiplier for the group must follow the closing parenthesis.
That is, all element and group multipliers are assumed to be
printed as subscripted numbers. (An exception to this rule
exists for attribute moiety in category chemical_formula formulae where pre- and
post-multipliers are permitted for molecular units.)
(5) Unless the elements are ordered in a manner that corresponds
to their chemical structure, as in
attribute structural in category chemical_formula the order of the elements within
any group or moiety should be: C, then H, then the other
elements in alphabetical order of their symbol. This is the
'Hill' system used by Chemical Abstracts. This ordering is
used in _chemical_formula.moiety and _chemical_formula.sum.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<mmCIF:chemical_formulaCategory>
<mmCIF:chemical_formula entry_id="TOZ">
<mmCIF:moiety>C18 H25 N O3</mmCIF:moiety>
<mmCIF:sum>C18 H25 N O3</mmCIF:sum>
<mmCIF:weight>303.40</mmCIF:weight>
</mmCIF:chemical_formula>
</mmCIF:chemical_formulaCategory>
Formula determined by standard chemical analysis including trace
elements. See the CHEMICAL_FORMULA category description for
rules for writing chemical formulae. Parentheses are used only
for standard uncertainties (estimated standard deviations).
Fe2.45(2) Ni1.60(3) S4
Formula expressed in conformance with IUPAC rules for inorganic
and metal-organic compounds where these conflict with the rules
for any other CHEMICAL_FORMULA entries. Typically used for
formatting a formula in accordance with journal rules. This
should appear in the data block in addition to the most
appropriate of the other CHEMICAL_FORMULA data names.
Ref: IUPAC (1990). Nomenclature of Inorganic Chemistry.
Oxford: Blackwell Scientific Publications.
[Co Re (C12 H22 P)2 (C O)6].0.5C H3 O H
Formula with each discrete bonded residue or ion shown as a
separate moiety. See the CHEMICAL_FORMULA category description
for rules for writing chemical formulae. In addition to the
general formulae requirements, the following rules apply:
(1) Moieties are separated by commas ','.
(2) The order of elements within a moiety follows general rule
(5) in the CHEMICAL_FORMULA category description.
(3) Parentheses are not used within moieties but may surround
a moiety. Parentheses may not be nested.
(4) Charges should be placed at the end of the moiety. The
charge '+' or '-' may be preceded by a numerical multiplier
and should be separated from the last (element symbol +
count) by a space. Pre- or post-multipliers may be used for
individual moieties.
C7 H4 Cl Hg N O3 S
C12 H17 N4 O S 1+, C6 H2 N3 O7 1-
C12 H16 N2 O6, 5(H2 O1)
(Cd 2+)3, (C6 N6 Cr 3-)2, 2(H2 O)
See the CHEMICAL_FORMULA category description for the rules for
writing chemical formulae for inorganics, organometallics, metal
complexes etc., in which bonded groups are preserved as
discrete entities within parentheses, with post-multipliers as
required. The order of the elements should give as much
information as possible about the chemical structure.
Parentheses may be used and nested as required. This formula
should correspond to the structure as actually reported, i.e.
trace elements not included in atom-type and atom-site data
should not be included in this formula (see also
attribute analytical) in category chemical_formula.
Ca ((Cl O3)2 O)2 (H2 O)6
(Pt (N H3)2 (C5 H7 N3 O)2) (Cl O4)2
See the CHEMICAL_FORMULA category description for the rules
for writing chemical formulae in which all discrete bonded
residues and ions are summed over the constituent elements,
following the ordering given in general rule (5) in the
CHEMICAL_FORMULA category description. Parentheses are not
normally used.
C18 H19 N7 O8 S
Formula mass in daltons. This mass should correspond to the
formulae given under attribute structural,
in category chemical_formula _chemical_formula.moiety or _chemical_formula.sum and,
together with the Z value and cell parameters, should
yield the density given as attribute density_diffrn in category exptl_crystal.
Formula mass in daltons measured by a non-diffraction experiment.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CITATION category record details about the
literature cited as being relevant to the contents of the data
block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:citationCategory>
<mmCIF:citation id="primary">
<mmCIF:coordinate_linkage>yes</mmCIF:coordinate_linkage>
<mmCIF:title> Crystallographic analysis of a complex between human
immunodeficiency virus type 1 protease and acetyl-pepstatin
at 2.0-Angstroms resolution.</mmCIF:title>
<mmCIF:country>US</mmCIF:country>
<mmCIF:journal_abbrev>J. Biol. Chem.</mmCIF:journal_abbrev>
<mmCIF:journal_volume>265</mmCIF:journal_volume>
<mmCIF:page_first>14209</mmCIF:page_first>
<mmCIF:page_last>14219</mmCIF:page_last>
<mmCIF:year>1990</mmCIF:year>
<mmCIF:journal_id_ASTM>HBCHA3</mmCIF:journal_id_ASTM>
<mmCIF:journal_id_ISSN>0021-9258</mmCIF:journal_id_ISSN>
<mmCIF:journal_id_CSD>071</mmCIF:journal_id_CSD>
<mmCIF:details> The publication that directly relates to this coordinate
set.</mmCIF:details>
</mmCIF:citation>
<mmCIF:citation id="2">
<mmCIF:coordinate_linkage>no</mmCIF:coordinate_linkage>
<mmCIF:title> Three-dimensional structure of aspartyl-protease from human
immunodeficiency virus HIV-1.</mmCIF:title>
<mmCIF:country>UK</mmCIF:country>
<mmCIF:journal_abbrev>Nature</mmCIF:journal_abbrev>
<mmCIF:journal_volume>337</mmCIF:journal_volume>
<mmCIF:page_first>615</mmCIF:page_first>
<mmCIF:page_last>619</mmCIF:page_last>
<mmCIF:year>1989</mmCIF:year>
<mmCIF:journal_id_ASTM>NATUAS</mmCIF:journal_id_ASTM>
<mmCIF:journal_id_ISSN>0028-0836</mmCIF:journal_id_ISSN>
<mmCIF:journal_id_CSD>006</mmCIF:journal_id_CSD>
<mmCIF:details> Determination of the structure of the unliganded enzyme.</mmCIF:details>
</mmCIF:citation>
<mmCIF:citation id="3">
<mmCIF:coordinate_linkage>no</mmCIF:coordinate_linkage>
<mmCIF:title> Crystallization of the aspartylprotease from human
immunodeficiency virus, HIV-1.</mmCIF:title>
<mmCIF:country>US</mmCIF:country>
<mmCIF:journal_abbrev>J. Biol. Chem.</mmCIF:journal_abbrev>
<mmCIF:journal_volume>264</mmCIF:journal_volume>
<mmCIF:page_first>1919</mmCIF:page_first>
<mmCIF:page_last>1921</mmCIF:page_last>
<mmCIF:year>1989</mmCIF:year>
<mmCIF:journal_id_ASTM>HBCHA3</mmCIF:journal_id_ASTM>
<mmCIF:journal_id_ISSN>0021-9258</mmCIF:journal_id_ISSN>
<mmCIF:journal_id_CSD>071</mmCIF:journal_id_CSD>
<mmCIF:details> Crystallization of the unliganded enzyme.</mmCIF:details>
</mmCIF:citation>
<mmCIF:citation id="4">
<mmCIF:coordinate_linkage>no</mmCIF:coordinate_linkage>
<mmCIF:title> Human immunodeficiency virus protease. Bacterial expression
and characterization of the purified aspartic protease.</mmCIF:title>
<mmCIF:country>US</mmCIF:country>
<mmCIF:journal_abbrev>J. Biol. Chem.</mmCIF:journal_abbrev>
<mmCIF:journal_volume>264</mmCIF:journal_volume>
<mmCIF:page_first>2307</mmCIF:page_first>
<mmCIF:page_last>2312</mmCIF:page_last>
<mmCIF:year>1989</mmCIF:year>
<mmCIF:journal_id_ASTM>HBCHA3</mmCIF:journal_id_ASTM>
<mmCIF:journal_id_ISSN>0021-9258</mmCIF:journal_id_ISSN>
<mmCIF:journal_id_CSD>071</mmCIF:journal_id_CSD>
<mmCIF:details> Expression and purification of the enzyme.</mmCIF:details>
</mmCIF:citation>
</mmCIF:citationCategory>
Abstract for the citation. This is used most when the
citation is extracted from a bibliographic database that
contains full text or abstract information.
The Chemical Abstracts Service (CAS) abstract identifier;
relevant for journal articles.
The International Standard Book Number (ISBN) code assigned to
the book cited; relevant for books or book chapters.
The name of the publisher of the citation; relevant
for books or book chapters.
John Wiley and Sons
The location of the publisher of the citation; relevant
for books or book chapters.
London
The title of the book in which the citation appeared; relevant
for books or book chapters.
attribute coordinate_linkage in category citation states whether this citation
is concerned with precisely the set of coordinates given in the
data block. If, for instance, the publication described the same
structure, but the coordinates had undergone further refinement
prior to the creation of the data block, the value of this data
item would be 'no'.
The country of publication; relevant for books
and book chapters.
Identifier ('refcode') of the database record in the Cambridge
Structural Database that contains details of the cited structure.
LEKKUH
Accession number used by Medline to categorize a specific
bibliographic entry.
89064067
A description of special aspects of the relationship
of the contents of the data block to the literature item cited.
citation relates to this precise
coordinate set
citation relates to earlier low-resolution
structure
citation relates to further refinement of
structure reported in citation 2
Abbreviated name of the cited journal as given in the
Chemical Abstracts Service Source Index.
J. Mol. Biol.
Full name of the cited journal; relevant for journal articles.
Journal of Molecular Biology
The American Society for Testing and Materials (ASTM) code
assigned to the journal cited (also referred to as the CODEN
designator of the Chemical Abstracts Service); relevant for
journal articles.
The Cambridge Structural Database (CSD) code assigned to the
journal cited; relevant for journal articles. This is also the
system used at the Protein Data Bank (PDB).
0070
The International Standard Serial Number (ISSN) code assigned to
the journal cited; relevant for journal articles.
Issue number of the journal cited; relevant for journal
articles.
2
Volume number of the journal cited; relevant for journal
articles.
174
Language in which the cited article is written.
German
The first page of the citation; relevant for journal
articles, books and book chapters.
The last page of the citation; relevant for journal
articles, books and book chapters.
Document Object Identifier used by doi.org to uniquely
specify bibliographic entry.
DOI:10.2345/S1384107697000225
Ascession number used by PubMed to categorize a specific
bibliographic entry.
12627512
The title of the citation; relevant for journal articles, books
and book chapters.
Structure of diferric duck ovotransferrin
at 2.35 \%A resolution.
Flag to indicate that this citation will not be published.
The year of the citation; relevant for journal articles, books
and book chapters.
1984
The value of attribute id in category citation must uniquely identify a record in the
CITATION list.
The attribute id in category citation 'primary' should be used to indicate the
citation that the author(s) consider to be the most pertinent to
the contents of the data block.
Note that this item need not be a number; it can be any unique
identifier.
primary
1
2
Data items in the CITATION_AUTHOR category record details
about the authors associated with the citations in the
CITATION list.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:citation_authorCategory>
<mmCIF:citation_author citation_id="primary" name="Fitzgerald, P.M.D.">
<mmCIF:ordinal>1</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="McKeever, B.M.">
<mmCIF:ordinal>2</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Van Middlesworth, J.F.">
<mmCIF:ordinal>3</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Springer, J.P.">
<mmCIF:ordinal>4</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Heimbach, J.C.">
<mmCIF:ordinal>5</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Leu, C.-T.">
<mmCIF:ordinal>6</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Herber, W.K.">
<mmCIF:ordinal>7</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Dixon, R.A.F.">
<mmCIF:ordinal>8</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="primary" name="Darke, P.L.">
<mmCIF:ordinal>9</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Navia, M.A.">
<mmCIF:ordinal>1</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Fitzgerald, P.M.D.">
<mmCIF:ordinal>2</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="McKeever, B.M.">
<mmCIF:ordinal>3</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Leu, C.-T.">
<mmCIF:ordinal>4</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Heimbach, J.C.">
<mmCIF:ordinal>5</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Herber, W.K.">
<mmCIF:ordinal>6</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Sigal, I.S.">
<mmCIF:ordinal>7</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Darke, P.L.">
<mmCIF:ordinal>8</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="2" name="Springer, J.P.">
<mmCIF:ordinal>9</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="McKeever, B.M.">
<mmCIF:ordinal>1</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Navia, M.A.">
<mmCIF:ordinal>2</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Fitzgerald, P.M.D.">
<mmCIF:ordinal>3</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Springer, J.P.">
<mmCIF:ordinal>4</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Leu, C.-T.">
<mmCIF:ordinal>5</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Heimbach, J.C.">
<mmCIF:ordinal>6</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Herber, W.K.">
<mmCIF:ordinal>7</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Sigal, I.S.">
<mmCIF:ordinal>8</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="3" name="Darke, P.L.">
<mmCIF:ordinal>9</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Darke, P.L.">
<mmCIF:ordinal>1</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Leu, C.-T.">
<mmCIF:ordinal>2</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Davis, L.J.">
<mmCIF:ordinal>3</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Heimbach, J.C.">
<mmCIF:ordinal>4</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Diehl, R.E.">
<mmCIF:ordinal>5</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Hill, W.S.">
<mmCIF:ordinal>6</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Dixon, R.A.F.">
<mmCIF:ordinal>7</mmCIF:ordinal>
</mmCIF:citation_author>
<mmCIF:citation_author citation_id="4" name="Sigal, I.S.">
<mmCIF:ordinal>8</mmCIF:ordinal>
</mmCIF:citation_author>
</mmCIF:citation_authorCategory>
This data item is a pointer to attribute id in category citation in the CITATION
category.
Name of an author of the citation; relevant for journal
articles, books and book chapters.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
This data item defines the order of the author's name in the
list of authors of a citation.
Data items in the CITATION_EDITOR category record details
about the editors associated with the books or book chapters
cited in the CITATION list.
Example 1 - hypothetical example.
<mmCIF:citation_editorCategory>
<mmCIF:citation_editor citation_id="5" name="McKeever, B.M."></mmCIF:citation_editor>
<mmCIF:citation_editor citation_id="5" name="Navia, M.A."></mmCIF:citation_editor>
<mmCIF:citation_editor citation_id="5" name="Fitzgerald, P.M.D."></mmCIF:citation_editor>
<mmCIF:citation_editor citation_id="5" name="Springer, J.P."></mmCIF:citation_editor>
</mmCIF:citation_editorCategory>
This data item defines the order of the editor's name in the
list of editors of a citation.
This data item is a pointer to attribute id in category citation in the CITATION
category.
Names of an editor of the citation; relevant for books and
book chapters.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the COMPUTING category record details about the
computer programs used in the crystal structure analysis.
Data items in this category would not, in general, be used in
a macromolecular CIF. The category SOFTWARE, which allows
a more detailed description of computer programs and
their attributes to be given, would be used instead.
Example 1 - Rodr\'iguez-Romera, Ruiz-P\'erez & Solans [Acta
Cryst. (1996), C52, 1415-1417].
<mmCIF:computingCategory>
<mmCIF:computing>
<mmCIF:data_collection>CAD-4 (Enraf-Nonius, 1989)</mmCIF:data_collection>
<mmCIF:cell_refinement>CAD-4 (Enraf-Nonius, 1989)</mmCIF:cell_refinement>
<mmCIF:data_reduction>CFEO (Solans, 1978)</mmCIF:data_reduction>
<mmCIF:structure_solution>SHELXS86 (Sheldrick, 1990)</mmCIF:structure_solution>
<mmCIF:structure_refinement>SHELXL93 (Sheldrick, 1993)</mmCIF:structure_refinement>
<mmCIF:molecular_graphics>ORTEPII (Johnson, 1976)</mmCIF:molecular_graphics>
<mmCIF:publication_material>PARST (Nardelli, 1983)</mmCIF:publication_material>
</mmCIF:computing>
</mmCIF:computingCategory>
Software used for cell refinement.
Give the program or package name and a brief reference.
CAD4 (Enraf-Nonius, 1989)
Software used for data collection.
Give the program or package name and a brief reference.
CAD4 (Enraf-Nonius, 1989)
Software used for data reduction.
Give the program or package name and a brief reference.
DIFDAT, SORTRF, ADDREF (Hall & Stewart, 1990)
Software used for molecular graphics.
Give the program or package name and a brief reference.
FRODO (Jones, 1986), ORTEP (Johnson, 1965)
Program/package name for data reduction/data scaling
Program/package name for data reduction/intensity integration software
Program/package name for structure refinement method.
Software used for generating material for publication.
Give the program or package name and a brief reference.
Software used for refinement of the structure.
Give the program or package name and a brief reference.
SHELX85 (Sheldrick, 1985)
X-PLOR (Brunger, 1992)
Software used for solution of the structure.
Give the program or package name and a brief reference.
SHELX85 (Sheldrick, 1985)
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE category have been superseded by
data items in the DATABASE_2 category. They are included
here only for compliance with older CIFs.
A history of changes made by the Cambridge Crystallographic Data
Centre and incorporated into the Cambridge Structural Database
(CSD).
The code assigned by Chemical Abstracts.
The code assigned by the Cambridge Structural Database.
The code assigned by the Inorganic Crystal Structure
Database.
The code assigned by the Metals Data File.
The code assigned by the NBS (NIST) Crystal Data Database.
The code assigned by the Protein Data Bank.
The code assigned by the Powder Diffraction File (JCPDS/ICDD).
Deposition numbers assigned by the Cambridge Crystallographic
Data Centre (CCDC) to files containing structural information
archived by the CCDC.
Deposition numbers assigned by the Fachinformationszentrum
Karlsruhe (FIZ) to files containing structural information
archived by the Cambridge Crystallographic Data Centre (CCDC).
Deposition numbers assigned by various journals to files
containing structural information archived by the Cambridge
Crystallographic Data Centre (CCDC).
The ASTM CODEN designator for a journal as given in the Chemical
Source List maintained by the Chemical Abstracts Service.
The journal code used in the Cambridge Structural Database.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE_2 category record details about the
database identifiers of the data block.
These data items are assigned by database managers and should
only appear in a data block if they originate from that source.
The name of this category, DATABASE_2, arose because the
category name DATABASE was already in use in the core CIF
dictionary, but was used differently from the way it needed
to be used in the mmCIF dictionary. Since CIF data names
cannot be changed once they have been adopted, a new category
had to be created.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:database_2Category>
<mmCIF:database_2 database_id="PDB" database_code="5HVP"></mmCIF:database_2>
</mmCIF:database_2Category>
An abbreviation that identifies the database.
The code assigned by the database identified in
attribute database_id in category database_2.
1ABC
ABCDEF
Data items in the DATABASE_PDB_CAVEAT category record details
about features of the data block flagged as 'caveats' by the
Protein Data Bank (PDB).
These data items are included only for consistency with PDB
format files. They should appear in a data block only if that
data block was created by reformatting a PDB format file.
Example 1 - hypothetical example.
<mmCIF:database_PDB_caveatCategory>
<mmCIF:database_PDB_caveat id="1">
<mmCIF:text> THE CRYSTAL TRANSFORMATION IS IN ERROR BUT IS</mmCIF:text>
</mmCIF:database_PDB_caveat>
<mmCIF:database_PDB_caveat id="2">
<mmCIF:text> UNCORRECTABLE AT THIS TIME</mmCIF:text>
</mmCIF:database_PDB_caveat>
</mmCIF:database_PDB_caveatCategory>
The full text of the PDB caveat record.
A unique identifier for the PDB caveat record.
The DATABASE_PDB_MATRIX category provides placeholders for
transformation matrices and vectors used by the Protein Data
Bank (PDB).
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
that data block was created by reformatting a PDB format file.
The [1][1] element of the PDB ORIGX matrix.
The [1][2] element of the PDB ORIGX matrix.
The [1][3] element of the PDB ORIGX matrix.
The [2][1] element of the PDB ORIGX matrix.
The [2][2] element of the PDB ORIGX matrix.
The [2][3] element of the PDB ORIGX matrix.
The [3][1] element of the PDB ORIGX matrix.
The [3][2] element of the PDB ORIGX matrix.
The [3][3] element of the PDB ORIGX matrix.
The [1] element of the PDB ORIGX vector.
The [2] element of the PDB ORIGX vector.
The [3] element of the PDB ORIGX vector.
The [1][1] element of the PDB SCALE matrix.
The [1][2] element of the PDB SCALE matrix.
The [1][3] element of the PDB SCALE matrix.
The [2][1] element of the PDB SCALE matrix.
The [2][2] element of the PDB SCALE matrix.
The [2][3] element of the PDB SCALE matrix.
The [3][1] element of the PDB SCALE matrix.
The [3][2] element of the PDB SCALE matrix.
The [3][3] element of the PDB SCALE matrix.
The [1] element of the PDB SCALE vector.
The [2] element of the PDB SCALE vector.
The [3] element of the PDB SCALE vector.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE_PDB_REMARK category record details
about the data block as archived by the Protein Data Bank (PDB).
Some data appearing in PDB REMARK records can be
algorithmically extracted into the appropriate data items
in the data block.
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
that data block was created by reformatting a PDB format file.
NOTE: These remark records in this category are not uniformly
annotated by the PDB and may not be consistent with
nomenclature or labeling used in the entry.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:database_PDB_remarkCategory>
<mmCIF:database_PDB_remark id="3">
<mmCIF:text> REFINEMENT. BY THE RESTRAINED LEAST-SQUARES PROCEDURE OF J.
KONNERT AND W. HENDRICKSON (PROGRAM *PROLSQ*). THE R
VALUE IS 0.176 FOR 12901 REFLECTIONS IN THE RESOLUTION
RANGE 8.0 TO 2.0 ANGSTROMS WITH I .GT. SIGMA(I).
RMS DEVIATIONS FROM IDEAL VALUES (THE VALUES OF
SIGMA, IN PARENTHESES, ARE THE INPUT ESTIMATED
STANDARD DEVIATIONS THAT DETERMINE THE RELATIVE
WEIGHTS OF THE CORRESPONDING RESTRAINTS)
DISTANCE RESTRAINTS (ANGSTROMS)
BOND DISTANCE 0.018(0.020)
ANGLE DISTANCE 0.038(0.030)
PLANAR 1-4 DISTANCE 0.043(0.040)
PLANE RESTRAINT (ANGSTROMS) 0.015(0.020)
CHIRAL-CENTER RESTRAINT (ANGSTROMS**3) 0.177(0.150)
NON-BONDED CONTACT RESTRAINTS (ANGSTROMS)
SINGLE TORSION CONTACT 0.216(0.500)
MULTIPLE TORSION CONTACT 0.207(0.500)
POSSIBLE HYDROGEN BOND 0.245(0.500)
CONFORMATIONAL TORSION ANGLE RESTRAINT (DEGREES)
PLANAR (OMEGA) 2.6(3.0)
STAGGERED 17.4(15.0)
ORTHONORMAL 18.1(20.0)</mmCIF:text>
</mmCIF:database_PDB_remark>
<mmCIF:database_PDB_remark id="4">
<mmCIF:text> THE TWO CHAINS OF THE DIMERIC ENZYME HAS BEEN ASSIGNED THE
THE CHAIN INDICATORS *A* AND *B*.</mmCIF:text>
</mmCIF:database_PDB_remark>
</mmCIF:database_PDB_remarkCategory>
The full text of the PDB remark record.
A unique identifier for the PDB remark record.
Data items in the DATABASE_PDB_REV category record details
about the history of the data block as archived by the Protein
Data Bank (PDB).
These data items are assigned by the PDB database managers and
should only appear in a data block if they originate from that
source.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:database_PDB_revCategory>
<mmCIF:database_PDB_rev num="1">
<mmCIF:author_name>Fitzgerald, Paula M.D</mmCIF:author_name>
<mmCIF:date>1991-10-15</mmCIF:date>
<mmCIF:date_original>1990-04-30</mmCIF:date_original>
<mmCIF:status>full release</mmCIF:status>
<mmCIF:mod_type>0</mmCIF:mod_type>
</mmCIF:database_PDB_rev>
</mmCIF:database_PDB_revCategory>
The name of the person responsible for submitting this revision
to the PDB.
The family name(s) followed by a comma precedes the first
name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Date the PDB revision took place. Taken from the REVDAT record.
Date the entry first entered the PDB database in the form
yyyy-mm-dd. Taken from the PDB HEADER record.
1980-08-21
Taken from the REVDAT record. Refer to the Protein Data Bank
format description at
http://www.rcsb.org/pdb/docs/format/pdbguide2.2/guide2.2_frame.html
for details.
The PDB code for a subsequent PDB entry that replaced the
PDB file corresponding to this data block.
The PDB code for a previous PDB entry that was replaced by
the PDB file corresponding to this data block.
The status of this revision.
The value of attribute num in category database_PDB_rev must uniquely and
sequentially identify a record in the DATABASE_PDB_REV list.
Note that this item must be a number and that modification
numbers are assigned in increasing numerical order.
Data items in the DATABASE_PDB_REV_RECORD category record
details about specific record types that were changed in a
given revision of a PDB entry.
These data items are assigned by the PDB database managers and
should only appear in a data block if they originate from that
source.
Example 1 - hypothetical example.
<mmCIF:database_PDB_rev_recordCategory>
<mmCIF:database_PDB_rev_record rev_num="1" type="CONECT">
<mmCIF:details> Error fix - incorrect connection between
atoms 2312 and 2317</mmCIF:details>
</mmCIF:database_PDB_rev_record>
<mmCIF:database_PDB_rev_record rev_num="2" type="MATRIX">
<mmCIF:details>For consistency with 1995-08-04 style-guide</mmCIF:details>
</mmCIF:database_PDB_rev_record>
<mmCIF:database_PDB_rev_record rev_num="3" type="ORIGX">
<mmCIF:details>Based on new data from author</mmCIF:details>
</mmCIF:database_PDB_rev_record>
</mmCIF:database_PDB_rev_recordCategory>
A description of special aspects of the revision of records in
this PDB entry.
Based on new data from author
For consistency with 1995-08-04 style-guide
For consistency with structural class
This data item is a pointer to attribute num in category database_PDB_rev in the
DATABASE_PDB_REV category.
The types of records that were changed in this revision to a
PDB entry.
CRYST1
SCALE
MTRIX
ATOM
HETATM
The DATABASE_PDB_TVECT category provides placeholders for
the TVECT matrices and vectors used by the Protein Data
Bank (PDB).
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
the data block was created by reformatting a PDB format file.
A description of special aspects of this TVECT.
The [1] element of the PDB TVECT vector.
The [2] element of the PDB TVECT vector.
The [3] element of the PDB TVECT vector.
The value of attribute id in category database_PDB_tvect must uniquely identify a
record in the DATABASE_PDB_TVECT list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the DIFFRN category record details about the
diffraction data and their measurement.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrnCategory>
<mmCIF:diffrn id="Set1">
<mmCIF:ambient_temp>293(3).</mmCIF:ambient_temp>
<mmCIF:ambient_environment> Mother liquor from the reservoir of the vapor diffusion experiment, mounted in room air</mmCIF:ambient_environment>
<mmCIF:crystal_support> 0.7 mm glass capillary, sealed with dental wax</mmCIF:crystal_support>
<mmCIF:crystal_treatment> Equilibrated in rotating anode radiation enclosure for
18 hours prior to beginning of data collection</mmCIF:crystal_treatment>
</mmCIF:diffrn>
</mmCIF:diffrnCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<mmCIF:diffrnCategory>
<mmCIF:diffrn id="d1">
<mmCIF:details> \q scan width (1.0 + 0.14tan\q)\%, \q scan rate 1.2\% per
min. Background counts for 5 sec on each side every scan.</mmCIF:details>
<mmCIF:ambient_temp>293.</mmCIF:ambient_temp>
</mmCIF:diffrn>
</mmCIF:diffrnCategory>
The gas or liquid surrounding the sample, if not air.
The mean hydrostatic pressure in kilopascals at which the
intensities were measured.
The estimated standard deviation of attribute ambient_pressure in category diffrn.
The mean hydrostatic pressure in kilopascals above which
the intensities were measured. attribute ambient_pressure_gt in category diffrn and
attribute ambient_pressure_lt in category diffrn allow a pressure range to be given.
attribute ambient_pressure in category diffrn should always be used in
preference to these two items whenever possible.
The mean hydrostatic pressure in kilopascals below which
the intensities were measured. attribute ambient_pressure_gt in category diffrn and
attribute ambient_pressure_lt in category diffrn allow a pressure range to be given.
attribute ambient_pressure in category diffrn should always be used in
preference to these two items whenever possible.
The mean temperature in kelvins at which the intensities were
measured.
A description of special aspects of temperature control during
data collection.
The standard uncertainty (estimated standard deviation)
of attribute ambient_temp in category diffrn.
The mean temperature in kelvins above which the intensities were
measured. _diffrn.ambient_temp_gt and _diffrn.ambient_temp_lt
allow a range of temperatures to be given.
attribute ambient_temp in category diffrn should always be used in preference
to these two items whenever possible.
The mean temperature in kelvins below which the intensities were
measured. _diffrn.ambient_temp_gt and _diffrn.ambient_temp_lt
allow a range of temperatures to be given.
attribute ambient_temp in category diffrn should always be used in preference
to these two items whenever possible.
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
The physical device used to support the crystal during data
collection.
glass capillary
quartz capillary
fiber
metal loop
Remarks about how the crystal was treated prior to intensity
measurement. Particularly relevant when intensities were
measured at low temperature.
equilibrated in hutch for 24 hours
flash frozen in liquid nitrogen
slow cooled with direct air stream
Special details of the diffraction measurement process. Should
include information about source instability, crystal motion,
degradation and so on.
This data item uniquely identifies a set of diffraction
data.
Data items in the DIFFRN_ATTENUATOR category record details
about the diffraction attenuator scales employed.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:diffrn_attenuatorCategory>
<mmCIF:diffrn_attenuator code="1">
<mmCIF:scale>16.976</mmCIF:scale>
</mmCIF:diffrn_attenuator>
</mmCIF:diffrn_attenuatorCategory>
Material from which the attenuator is made.
The scale factor applied when an intensity measurement is
reduced by an attenuator identified by attribute code.
in category diffrn_attenuator The measured intensity must be multiplied by this scale to
convert it to the same scale as unattenuated intensities.
A code associated with a particular attenuator setting. This
code is referenced by the attribute attenuator_code in category diffrn_refln which is
stored with the diffraction data. See attribute scale in category diffrn_attenuator.
Data items in the DIFFRN_DETECTOR category describe the
detector used to measure the scattered radiation, including
any analyser and post-sample collimation.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrn_detectorCategory>
<mmCIF:diffrn_detector diffrn_id="d1">
<mmCIF:detector>multiwire</mmCIF:detector>
<mmCIF:type>Siemens</mmCIF:type>
</mmCIF:diffrn_detector>
</mmCIF:diffrn_detectorCategory>
The resolution of an area detector, in pixels/mm.
A description of special aspects of the radiation detector.
The general class of the radiation detector.
photographic film
scintillation counter
CCD plate
BF~3~ counter
The deadtime in microseconds of the detector used to measure
the diffraction intensities.
The date of data collection.
1996-12-25
The total number of seconds required to measure this
data set.
120.0
The total number of data frames collected for this
data set.
20
100
The make, model or name of the detector device used.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_MEASUREMENT category record details
about the device used to orient and/or position the crystal
during data measurement and the manner in which the diffraction
data were measured.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrn_measurementCategory>
<mmCIF:diffrn_measurement diffrn_id="d1">
<mmCIF:device>3-circle camera</mmCIF:device>
<mmCIF:device_type>Supper model x</mmCIF:device_type>
<mmCIF:device_details>none</mmCIF:device_details>
<mmCIF:method>omega scan</mmCIF:method>
<mmCIF:details> 440 frames, 0.20 degrees, 150 sec, detector distance 12 cm,
detector angle 22.5 degrees</mmCIF:details>
</mmCIF:diffrn_measurement>
</mmCIF:diffrn_measurementCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:diffrn_measurementCategory>
<mmCIF:diffrn_measurement diffrn_id="s1">
<mmCIF:device_type>Philips PW1100/20 diffractometer</mmCIF:device_type>
<mmCIF:method>\q/2\q</mmCIF:method>
</mmCIF:diffrn_measurement>
</mmCIF:diffrn_measurementCategory>
A description of special aspects of the intensity measurement.
440 frames, 0.20 degrees, 150 sec, detector
distance 12 cm, detector angle 22.5 degrees
The general class of goniometer or device used to support and
orient the specimen.
3-circle camera
4-circle camera
kappa-geometry camera
oscillation camera
precession camera
A description of special aspects of the device used to measure
the diffraction intensities.
commercial goniometer modified locally to
allow for 90\% \t arc
The make, model or name of the measurement device
(goniometer) used.
Supper model q
Huber model r
Enraf-Nonius model s
homemade
Method used to measure intensities.
profile data from theta/2theta scans
The physical device used to support the crystal during data
collection.
glass capillary
quartz capillary
fiber
metal loop
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_ORIENT_MATRIX category record details
about the orientation matrix used in the measurement of the
diffraction data.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2(THF)4.
<mmCIF:diffrn_orient_matrixCategory>
<mmCIF:diffrn_orient_matrix diffrn_id="set1">
<mmCIF:type> reciprocal axis matrix, multiplies hkl vector to generate
diffractometer xyz vector and diffractometer angles</mmCIF:type>
<mmCIF:UB11>-0.071479</mmCIF:UB11>
<mmCIF:UB12>0.020208</mmCIF:UB12>
<mmCIF:UB13>0.039076</mmCIF:UB13>
<mmCIF:UB21>0.035372</mmCIF:UB21>
<mmCIF:UB22>0.056209</mmCIF:UB22>
<mmCIF:UB23>0.078324</mmCIF:UB23>
<mmCIF:UB31>-0.007470</mmCIF:UB31>
<mmCIF:UB32>0.067854</mmCIF:UB32>
<mmCIF:UB33>-0.017832</mmCIF:UB33>
</mmCIF:diffrn_orient_matrix>
</mmCIF:diffrn_orient_matrixCategory>
The [1][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [1][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [1][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation with respect to the
local diffractometer axes. See also attribute type in category diffrn_orient_matrix.
A description of the orientation matrix type and how it should
be applied to define the orientation of the crystal precisely
with respect to the diffractometer axes.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_ORIENT_REFLN category record details
about the reflections that define the orientation matrix used in
the measurement of the diffraction intensities.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2(THF)4.
<mmCIF:diffrn_orient_reflnCategory>
<mmCIF:diffrn_orient_refln diffrn_id="myset1" index_h="2" index_k="0" index_l="2">
<mmCIF:angle_chi>-28.45</mmCIF:angle_chi>
<mmCIF:angle_kappa>-11.32</mmCIF:angle_kappa>
<mmCIF:angle_omega>5.33</mmCIF:angle_omega>
<mmCIF:angle_phi>101.78</mmCIF:angle_phi>
<mmCIF:angle_psi>0.00</mmCIF:angle_psi>
<mmCIF:angle_theta>10.66</mmCIF:angle_theta>
</mmCIF:diffrn_orient_refln>
</mmCIF:diffrn_orient_reflnCategory>
Diffractometer angle chi of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices
in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle kappa of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices
in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle omega of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices in
the DIFFRN_ORIENT_REFLN category.
Diffractometer angle phi of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices
in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle psi of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices
in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle theta of a reflection used to
define the orientation matrix in degrees. See
attribute UB[][] in category diffrn_orient_matrix and the Miller indices
in the DIFFRN_ORIENT_REFLN category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Miller index h of a reflection used to define the orientation
matrix.
Miller index k of a reflection used to define the orientation
matrix.
Miller index l of a reflection used to define the orientation
matrix.
Data items in the DIFFRN_RADIATION category describe
the radiation used in measuring the diffraction intensities,
its collimation and monochromatization before the sample.
Post-sample treatment of the beam is described by data
items in the DIFFRN_DETECTOR category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrn_radiationCategory>
<mmCIF:diffrn_radiation diffrn_id="set1">
<mmCIF:collimation>0.3 mm double pinhole</mmCIF:collimation>
<mmCIF:monochromator>graphite</mmCIF:monochromator>
<mmCIF:type>Cu K\a</mmCIF:type>
<mmCIF:wavelength_id>1</mmCIF:wavelength_id>
</mmCIF:diffrn_radiation>
</mmCIF:diffrn_radiationCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:diffrn_radiationCategory>
<mmCIF:diffrn_radiation>
<mmCIF:wavelength_id>1</mmCIF:wavelength_id>
<mmCIF:type>Cu K\a</mmCIF:type>
<mmCIF:monochromator>graphite</mmCIF:monochromator>
</mmCIF:diffrn_radiation>
</mmCIF:diffrn_radiationCategory>
The collimation or focusing applied to the radiation.
0.3 mm double-pinhole
0.5 mm
focusing mirrors
Absorption edge in angstroms of the radiation filter used.
Half-width in millimetres of the incident beam in the
direction perpendicular to the diffraction plane.
The method used to obtain monochromatic radiation. If a mono-
chromator crystal is used, the material and the indices of the
Bragg reflection are specified.
Zr filter
Ge 220
none
equatorial mounted graphite
Indicates the method used to obtain monochromatic radiation.
attribute monochromator in category diffrn_radiation describes the primary beam
monochromator (pre-specimen monochromation).
attribute pdbx_analyzer in category diffrn_radiation specifies the
post-diffraction analyser (post-specimen) monochromation.
Note that monochromators may have either 'parallel' or
'antiparallel' orientation. It is assumed that the
geometry is parallel unless specified otherwise.
In a parallel geometry, the position of the monochromator
allows the incident beam and the final post-specimen
and post-monochromator beam to be as close to parallel
as possible. In a parallel geometry, the diffracting
planes in the specimen and monochromator will be parallel
when 2*theta(monochromator) is equal to 2*theta (specimen).
For further discussion see R. Jenkins and R. Snyder,
Introduction to X-ray Powder Diffraction, Wiley (1996),
pp. 164-5.
GE(111)
Zr filter
Ge 220
none
equatorial mounted graphite (0001)
Si (111), antiparallel
SINGLE WAVELENGTH, LAUE, or MAD.
SINGLE WAVELENGTH
MONOCHROMATIC
LAUE
MAD
OTHER
Monochromatic or Laue.
M
L
Wavelength of radiation.
Comma separated list of wavelengths or wavelength range.
The angle in degrees, as viewed from the specimen, between the
perpendicular component of the polarization and the diffraction
plane. See attribute polarisn_ratio in category diffrn_radiation.
Polarization ratio of the diffraction beam incident on the
crystal. This is the ratio of the perpendicularly polarized
to the parallel-polarized component of the radiation. The
perpendicular component forms an angle of
attribute polarisn_norm in category diffrn_radiation to the normal to the
diffraction plane of the sample (i.e. the plane containing
the incident and reflected beams).
The nature of the radiation used (i.e. the name of the
subatomic particle or the region of the electromagnetic
spectrum). It is strongly recommended that this information
is given, so that the probe radiation can be simply determined.
The nature of the radiation. This is typically a description
of the X-ray wavelength in Siegbahn notation.
CuK\a
Cu K\a~1~
Cu K-L~2,3~
white-beam
This data item is a pointer to attribute id
in category diffrn_radiation_wavelength in the DIFFRN_RADIATION_WAVELENGTH category.
The IUPAC symbol for the X-ray wavelength for the probe
radiation.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_RADIATION_WAVELENGTH category
describe the wavelength of the radiation used to measure the
diffraction intensities. Items may be looped to identify
and assign weights to distinct components of a
polychromatic beam.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrn_radiation_wavelengthCategory>
<mmCIF:diffrn_radiation_wavelength id="1">
<mmCIF:wavelength>1.54</mmCIF:wavelength>
<mmCIF:wt>1.0</mmCIF:wt>
</mmCIF:diffrn_radiation_wavelength>
</mmCIF:diffrn_radiation_wavelengthCategory>
The radiation wavelength in angstroms.
The relative weight of a wavelength identified by the code
attribute id in category diffrn_radiation_wavelength in the list of wavelengths.
The code identifying each value of
attribute wavelength.
in category diffrn_radiation_wavelength Items in the DIFFRN_RADIATION_WAVELENGTH category are looped
when multiple wavelengths are used.
This code is used to link with the DIFFRN_REFLN category.
The attribute wavelength_id in category diffrn_refln codes must match one of
the codes defined in this category.
x1
x2
neut
Data items in the DIFFRN_REFLN category record details about
the intensities in the diffraction data set
identified by attribute diffrn_id.
in category diffrn_refln
The DIFFRN_REFLN data items refer to individual intensity
measurements and must be included in looped lists.
The DIFFRN_REFLNS data items specify the parameters that apply
to all intensity measurements in the particular diffraction
data set identified by attribute diffrn_id in category diffrn_reflns.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2(THF)4 for data set 'set1' reflection 1102.
<mmCIF:diffrn_reflnCategory>
<mmCIF:diffrn_refln diffrn_id="set1" id="1102">
<mmCIF:wavelength_id>Cu1fixed</mmCIF:wavelength_id>
<mmCIF:angle_chi>32.21</mmCIF:angle_chi>
<mmCIF:angle_kappa>20.12</mmCIF:angle_kappa>
<mmCIF:angle_omega>11.54</mmCIF:angle_omega>
<mmCIF:angle_phi>176.02</mmCIF:angle_phi>
<mmCIF:angle_psi>0.00</mmCIF:angle_psi>
<mmCIF:angle_theta>23.08</mmCIF:angle_theta>
<mmCIF:attenuator_code>Ni.005</mmCIF:attenuator_code>
<mmCIF:counts_bg_1>22</mmCIF:counts_bg_1>
<mmCIF:counts_bg_2>25</mmCIF:counts_bg_2>
<mmCIF:counts_net>3450</mmCIF:counts_net>
<mmCIF:counts_peak>321</mmCIF:counts_peak>
<mmCIF:counts_total>3499</mmCIF:counts_total>
<mmCIF:detect_slit_horiz>0.04</mmCIF:detect_slit_horiz>
<mmCIF:detect_slit_vert>0.02</mmCIF:detect_slit_vert>
<mmCIF:elapsed_time>1.00</mmCIF:elapsed_time>
<mmCIF:index_h>4</mmCIF:index_h>
<mmCIF:index_k>0</mmCIF:index_k>
<mmCIF:index_l>2</mmCIF:index_l>
<mmCIF:intensity_net>202.56</mmCIF:intensity_net>
<mmCIF:intensity_sigma>2.18</mmCIF:intensity_sigma>
<mmCIF:scale_group_code>A24</mmCIF:scale_group_code>
<mmCIF:scan_mode>om</mmCIF:scan_mode>
<mmCIF:scan_mode_backgd>mo</mmCIF:scan_mode_backgd>
<mmCIF:scan_rate>1.2</mmCIF:scan_rate>
<mmCIF:scan_time_backgd>900.00</mmCIF:scan_time_backgd>
<mmCIF:scan_width>1.0</mmCIF:scan_width>
<mmCIF:sint_over_lambda>0.25426</mmCIF:sint_over_lambda>
<mmCIF:standard_code>1</mmCIF:standard_code>
<mmCIF:wavelength>1.54184</mmCIF:wavelength>
</mmCIF:diffrn_refln>
</mmCIF:diffrn_reflnCategory>
The diffractometer angle chi of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle kappa of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle omega of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle phi of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle psi of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle theta of a reflection in degrees. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The code identifying the attenuator setting for this reflection.
This code must match one of the attribute code in category diffrn_attenuator values.
The code identifying the class to which this reflection has
been assigned. This code must match a value of
attribute code in category diffrn_reflns_class. Reflections may be grouped into
classes for a variety of purposes. For example, for modulated
structures each reflection class may be defined by the
number m=sum|m~i~|, where the m~i~ are the integer coefficients
that, in addition to h,k,l, index the corresponding diffraction
vector in the basis defined for the reciprocal lattice.
The diffractometer counts for the measurement of the background
before the peak.
The diffractometer counts for the measurement of the background
after the peak.
The diffractometer counts for the measurement of net counts after
background removal.
The diffractometer counts for the measurement of counts for the
peak scan or position.
The diffractometer counts for the measurement of total counts
(background plus peak).
Total slit aperture in degrees in the diffraction plane.
Total slit aperture in degrees perpendicular to the
diffraction plane.
Elapsed time in minutes from the start of the diffraction
experiment to the measurement of this intensity.
Miller index h of a reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are given in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix[][] in category diffrn_reflns.
Miller index k of a reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are given in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix[][] in category diffrn_reflns.
Miller index l of a reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are given in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix[][] in category diffrn_reflns.
Net intensity calculated from the diffraction counts after the
attenuator and standard scales have been applied.
Standard uncertainty (estimated standard deviation) of the
intensity calculated from the diffraction counts after the
attenuator and standard scales have been applied.
Standard uncertainty of the net intensity calculated from
the diffraction counts after the attenuator and standard
scales have been applied.
The code identifying the scale applying to this reflection.
This data item is a pointer to attribute code in category diffrn_scale_group in the
DIFFRN_SCALE_GROUP category.
The code identifying the mode of scanning for measurements
using a diffractometer.
See _diffrn_refln.scan_width and _diffrn_refln.scan_mode_backgd.
The code identifying the mode of scanning a reflection to
measure the background intensity.
The rate of scanning a reflection in degrees per minute
to measure the intensity.
The time spent measuring each background in seconds.
The scan width in degrees of the scan mode defined by the code
attribute scan_mode in category diffrn_refln.
The (sin theta)/lambda value in reciprocal angstroms for this
reflection.
The code identifying that this reflection was measured as a
standard intensity.
This data item is a pointer to attribute code in category diffrn_standard_refln in the
DIFFRN_STANDARD_REFLN category.
The mean wavelength in angstroms of the radiation used to measure
the intensity of this reflection. This is an important parameter
for data collected using energy-dispersive detectors or the
Laue method.
This data item is a pointer to attribute wavelength_id in category diffrn_radiation in
the DIFFRN_RADIATION category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
The value of attribute id in category diffrn_refln must uniquely identify the
reflection in the data set identified by the item
attribute diffrn_id.
in category diffrn_refln
Note that this item need not be a number; it can be any unique
identifier.
Data items in the DIFFRN_REFLNS category record details about
the set of intensities measured in the diffraction experiment.
The DIFFRN_REFLN data items refer to individual intensity
measurements and must be included in looped lists.
The DIFFRN_REFLNS data items specify the parameters that apply
to all intensity measurements in a diffraction data set.
The residual [sum|avdel(I)| / sum|av(I)|] for symmetry-equivalent
reflections used to calculate the average intensity av(I). The
avdel(I) term is the average absolute difference between av(I)
and the individual symmetry-equivalent intensities.
Measure [sum|sigma(I)|/sum|net(I)|] for all measured reflections.
Measure [sum u(net I)|/sum|net I|] for all measured reflections.
The maximum value of the Miller index h for the
reflection data specified by attribute index_h in category diffrn_refln.
The minimum value of the Miller index h for the
reflection data specified by attribute index_h in category diffrn_refln.
The maximum value of the Miller index k for the
reflection data specified by attribute index_k in category diffrn_refln.
The minimum value of the Miller index k for the
reflection data specified by attribute index_k in category diffrn_refln.
The maximum value of the Miller index l for the
reflection data specified by attribute index_l in category diffrn_refln.
The minimum value of the Miller index l for the
reflection data specified by attribute index_l in category diffrn_refln.
The total number of measured intensities, excluding reflections
that are classified as systematically absent.
A description of the process used to reduce the intensity data
into structure-factor magnitudes.
data averaged using Fisher test
Maximum theta angle in degrees for the measured diffraction
intensities.
Minimum theta angle in degrees for the measured diffraction
intensities.
The [1][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [1][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [1][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_REFLNS_CLASS category record details
about the classes of reflections measured in the diffraction
experiment.
Example 1 - example corresponding to the one-dimensional incommensurately
modulated structure of K~2~SeO~4~. Each reflection class is
defined by the number m=sum|m~i~|, where the m~i~ are the
integer coefficients that, in addition to h,k,l, index the
corresponding diffraction vector in the basis defined for
the reciprocal lattice.
<mmCIF:diffrn_reflns_classCategory>
<mmCIF:diffrn_reflns_class code="Main">
<mmCIF:number>1580</mmCIF:number>
<mmCIF:d_res_high>0.551</mmCIF:d_res_high>
<mmCIF:d_res_low>6.136</mmCIF:d_res_low>
<mmCIF:av_R_eq>0.015</mmCIF:av_R_eq>
<mmCIF:description>m=0; main reflections</mmCIF:description>
</mmCIF:diffrn_reflns_class>
<mmCIF:diffrn_reflns_class code="Sat1">
<mmCIF:number>1045</mmCIF:number>
<mmCIF:d_res_high>0.551</mmCIF:d_res_high>
<mmCIF:d_res_low>6.136</mmCIF:d_res_low>
<mmCIF:av_R_eq>0.010</mmCIF:av_R_eq>
<mmCIF:description>m=1; first-order satellites</mmCIF:description>
</mmCIF:diffrn_reflns_class>
</mmCIF:diffrn_reflns_classCategory>
For each reflection class, the residual
[sum av|del(I)|/sum|av(I)|] for symmetry-equivalent reflections
used to calculate the average intensity av(I). The av|del(I)|
term is the average absolute difference between av(I) and the
individual intensities.
Measure [sum|sigma(net I)|/sum|net I|] for all measured intensities
in a reflection class.
Measure [sum|u(net I)|/sum|net I|] for all measured intensities
in a reflection class.
The smallest value in angstroms for the interplanar
spacings for the reflections in each measured reflection class.
This is called the highest resolution for this reflection class.
The largest value in angstroms of the interplanar
spacings for the reflections for each measured reflection class.
This is called the lowest resolution for this reflection class.
Description of each reflection class.
m=1 first order satellites
H0L0 common projection reflections
The total number of measured intensities for each reflection
class, excluding the systematic absences arising from
centring translations.
The code identifying a certain reflection class.
1
m1
s2
Data items in the DIFFRN_SCALE_GROUP category record details
of the scaling factors applied to place all intensities in the
reflection lists on a common scale.
Scaling groups might, for example, correspond to each film in a
multi-film data set or each crystal in a multi-crystal data set.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2(THF)4.
<mmCIF:diffrn_scale_groupCategory>
<mmCIF:diffrn_scale_group code="A24">
<mmCIF:I_net>1.021</mmCIF:I_net>
</mmCIF:diffrn_scale_group>
</mmCIF:diffrn_scale_groupCategory>
The scale for a specific measurement group which is to be
multiplied with the net intensity to place all intensities
in the DIFFRN_REFLN or REFLN list on a common scale.
The value of attribute code in category diffrn_scale_group must uniquely identify a
record in the DIFFRN_SCALE_GROUP list.
Note that this item need not be a number; it can be any unique
identifier.
1
2
c1
c2
Data items in the DIFFRN_SOURCE category record details of
the source of radiation used in the diffraction experiment.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:diffrn_sourceCategory>
<mmCIF:diffrn_source diffrn_id="s1">
<mmCIF:source>rotating anode</mmCIF:source>
<mmCIF:type>Rigaku RU-200</mmCIF:type>
<mmCIF:power>50.</mmCIF:power>
<mmCIF:current>180.</mmCIF:current>
<mmCIF:size>8mm x 0.4 mm broad-focus</mmCIF:size>
</mmCIF:diffrn_source>
</mmCIF:diffrn_sourceCategory>
The current in milliamperes at which the radiation source
was operated.
A description of special aspects of the radiation source used.
Synchrotron beamline.
Synchrotron site.
Wavelength of radiation.
Comma separated list of wavelengths or wavelength range.
The power in kilowatts at which the radiation source
was operated.
The dimensions of the source as viewed from the sample.
8mm x 0.4 mm fine-focus
broad focus
The general class of the radiation source.
sealed X-ray tube
nuclear reactor
spallation source
electron microscope
rotating-anode X-ray tube
synchrotron
The complement of the angle in degrees between the normal
to the surface of the X-ray tube target and the primary
X-ray beam for beams generated by traditional X-ray tubes.
1.5
The chemical element symbol for the X-ray target
(usually the anode) used to generate X-rays.
This can also be used for spallation sources.
The make, model or name of the source of radiation.
NSLS beamline X8C
Rigaku RU200
The voltage in kilovolts at which the radiation source was
operated.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_STANDARD_REFLN category record details
about the reflections treated as standards during the measurement
of a set of diffraction intensities.
Note that these are the individual standard reflections, not the
results of the analysis of the standard reflections.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:diffrn_standard_reflnCategory>
<mmCIF:diffrn_standard_refln diffrn_id="s1" code="1">
<mmCIF:index_h>3</mmCIF:index_h>
<mmCIF:index_k>2</mmCIF:index_k>
<mmCIF:index_l>4</mmCIF:index_l>
</mmCIF:diffrn_standard_refln>
<mmCIF:diffrn_standard_refln diffrn_id="s1" code="1">
<mmCIF:index_h>1</mmCIF:index_h>
<mmCIF:index_k>9</mmCIF:index_k>
<mmCIF:index_l>1</mmCIF:index_l>
</mmCIF:diffrn_standard_refln>
<mmCIF:diffrn_standard_refln diffrn_id="s1" code="1">
<mmCIF:index_h>3</mmCIF:index_h>
<mmCIF:index_k>0</mmCIF:index_k>
<mmCIF:index_l>10</mmCIF:index_l>
</mmCIF:diffrn_standard_refln>
</mmCIF:diffrn_standard_reflnCategory>
Miller index h of a standard reflection used in the diffraction
measurement process.
Miller index k of a standard reflection used in the diffraction
measurement process.
Miller index l of a standard reflection used in the diffraction
measurement process.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
The code identifying a reflection measured as a standard
reflection with the indices attribute index_h,
in category diffrn_standard_refln attribute index_k in category diffrn_standard_refln and
attribute index_l in category diffrn_standard_refln. This is the same code as the
attribute standard_code in category diffrn_refln in the DIFFRN_REFLN list.
1
2
c1
c2
Data items in the DIFFRN_STANDARDS category record details
about the set of standard reflections used to monitor intensity
stability during the measurement of diffraction intensities.
Note that these records describe properties common to the set of
standard reflections, not the standard reflections themselves.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:diffrn_standardsCategory>
<mmCIF:diffrn_standards diffrn_id="s1">
<mmCIF:number>3</mmCIF:number>
<mmCIF:interval_time>120.</mmCIF:interval_time>
<mmCIF:decay_>0.</mmCIF:decay_>
</mmCIF:diffrn_standards>
</mmCIF:diffrn_standardsCategory>
The percentage decrease in the mean of the intensities
for the set of standard reflections from the start of the
measurement process to the end. This value usually
affords a measure of the overall decay in crystal quality
during the diffraction measurement process. Negative values
are used in exceptional instances where the final intensities
are greater than the initial ones.
The number of reflection intensities between the measurement of
standard reflection intensities.
The time in minutes between the measurement of standard
reflection intensities.
The number of unique standard reflections used during the
measurement of the diffraction intensities.
The standard uncertainty (estimated standard deviation) of
the individual mean standard scales applied to the intensity
data.
The standard uncertainty of the individual mean
standard scales applied to the intensity data.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the EM_2D_CRYSTAL_GROW category
record details of growth conditions for 2d crystal samples.
Example 1 - based on PDB entry 1AT9 and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_2d_crystal_growCategory>
<PDBx:em_2d_crystal_grow id="1">
<PDBx:atmosphere>room air</PDBx:atmosphere>
<PDBx:pH>5.2</PDBx:pH>
<PDBx:temp>18.</PDBx:temp>
<PDBx:buffer_id>2</PDBx:buffer_id>
<PDBx:details>on grid</PDBx:details>
<PDBx:number_2d_crystals>129</PDBx:number_2d_crystals>
<PDBx:citation_id>2</PDBx:citation_id>
</PDBx:em_2d_crystal_grow>
</PDBx:em_2d_crystal_growCategory>
The type of the apparatus used for growing the crystals.
Langmuir trough
The type of atmosphere in which crystals were grown.
room air
This data item is a pointer to attribute id in category em_buffer in the
BUFFER category.
This data item is a pointer to attribute id
in category citation in the CITATION category.
Any additional items concerning 2d crystal growth.
The approximate size (microns squared) of 2d crystals imaged.
The method used for growing the crystals.
lipid monolayer
The number of 2d crystals imaged.
the pH value used for growing the crystals.
4.7
The value of the temperature in degrees Kelvin used for
growing the crystals.
293
The length of time required to grow the crystals.
approximately 2 days
The value of attribute crystal_id
in category em_2d_crystal_grow must uniquely identify the sample 2d crystal.
Data items in the EM_2D_PROJECTION_SELECTION category
record details of images from scanned micrographs and the
number of particles selected from a scanned set of micrographs.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_2d_projection_selectionCategory>
<PDBx:em_2d_projection_selection entry_id="1">
<PDBx:num_particles>5267</PDBx:num_particles>
<PDBx:software_name>1</PDBx:software_name>
<PDBx:method>INTERACTIVE</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
</PDBx:em_2d_projection_selection>
</PDBx:em_2d_projection_selectionCategory>
This data item is a pointer to attribute id in category citation in the
CITATION category.
Any additional details used for selecting observed assemblies.
negative monitor contrast facilitated particle picking
The method used for selecting observed assemblies.
particles picked interactively from monitor
The number of particles selected from the projection set of images.
840
This data item is a pointer to attribute name in category software in the
SOFTWARE category.
The value of attribute entry_id in category em_2d_projection_selection points to
the ENTRY category.
Data items in the 3D_FITTING category
record details of the method of fitting atomic
coordinates from a PDB file into a 3d-em
volume map file
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_fittingCategory>
<PDBx:em_3d_fitting id="1" entry_id="1DYL">
<PDBx:method>AUTOMATIC</PDBx:method>
<PDBx:target_criteria>R-FACTOR</PDBx:target_criteria>
<PDBx:software_name>1</PDBx:software_name>
<PDBx:ref_space>REAL</PDBx:ref_space>
<PDBx:ref_protocol>RIGID BODY REFINEMENT</PDBx:ref_protocol>
<PDBx:details> THE CRYSTAL STRUCTURE OF THE CAPSID
PROTEIN FROM CHOI ET AL (1997) PROTEINS 3 27:345-359
(SUBUNIT A OF PDB FILE 1VCQ) WAS PLACED INTO THE CRYO-EM
DENSITY MAP. THE CAPSID PROTEIN WAS FIRST MANUALLY POSITIONED
INTO THE CRYO-EM DENSITY CORRESPONDING TO POSITIONS OF THE
FOUR INDEPENDENT MONOMER DENSITIES BETWEEN THE INNER LEAFLET
OF THE BILAYER AND THE RNA. THESE POSITIONS WERE THEN REFINED
BY RIGID BODY REFINEMENT IN REAL SPACE WITH THE PROGRAM EMFIT
(CHENG ET AL. 1995, CELL 80, 621-630). THE QUALITY OF THE FIT
CAN BE SEEN FROM THE MAP DENSITY WITHIN THE PROTEIN. ALL 4563
ATOMS ARE IN DENSITY OF AT LEAST 4 SIGMA (96.73) ABOVE THE
AVERAGE (512.04), 1167 ATOMS ARE IN DENSITY BETWEEN 4 AND 5
SIGMA, 3174 ATOMS ARE IN DENSITY BETWEEN 5 AND 6 SIGMA, AND 222
ATOMS ARE IN DENSTY OF 6 SIGMA OR ABOVE. THE VARIATION IN
DENSITY OVER THE FITTED PROTEIN CAN BE VISUALIZED WITH THE
PSEUDO TEMPERATURE FACTOR. THE DENSITY VALUE AT EACH ATOM IS
GIVEN IN THE 8TH COLUM (USUALLY THE OCCUPANCY) AS THE NUMBER
OF STANDARD DEVIATION ABOVE BACKGROUND. COLUMN NINE (USUALLY
THE TEMPERATURE FACTOR) CONTAINS THE VALUE OF THE RELATIVE
DENSITY WITHIN THE FITTED PROTEIN SCALED LINEARLY SO THAT THE
MINIMUM DENSITY IS 100.0 AND THE MAXIMUM DENSITY IS 1.0. THE
ATOMS THAT LIE IN THE LOWER DENSITY REGIONS WILL HAVE THE
HIGHEST PSEUDO TEMPERATURE FACTORS. </PDBx:details>
</PDBx:em_3d_fitting>
</PDBx:em_3d_fittingCategory>
Any additional details regarding fitting of atomic
coordinates into the 3d-em volume.
partial
The method used to fit atomic coordinates
into the 3dem reconstructed map.
The overall B (temperature factor) value for the 3d-em volume.
The type of protocol used in the refinement.
rigid body
A flag to indicate whether fitting was carried out in real
or reciprocal refinement space.
This data item is a pointer to attribute name
in category software in the category.
The quality of fit of the atomic coordinates into the
3dem volume map.
best visual fit using the program O
The value of attribute id in category em_3d_fitting must uniquely identify
a fitting procedure of atomic coordinates
into 3dem reconstructed volume map.
This data item is a pointer to _entry_id in
the ENTRY category.
Data items in the 3D_FITTING_LIST category
lists the methods of fitting atomic coordinates from a PDB file
into a 3d-em volume map file
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_fitting_listCategory>
<PDBx:em_3d_fitting_list id="1" _3d_fitting_id="l">
<PDBx:pdb_entry_id>1VCQ</PDBx:pdb_entry_id>
</PDBx:em_3d_fitting_list>
</PDBx:em_3d_fitting_listCategory>
The chain id for the entry used in fitting.
The PDB code for the entry used in fitting.
This data item is a unique identifier.
The value of attribute 3d_fitting_id in category em_3d_fitting_list is a pointer
to attribute id in category em_3d_fitting in the 3d_fitting category
Data items in the EM_3D_RECONSTRUCTION category
record details of the 3D reconstruction procedure from 2D projections.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_reconstructionCategory>
<PDBx:em_3d_reconstruction entry_id="1DYL" id="1">
<PDBx:method>CROSS-COMMON LINES</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:resolution>9.</PDBx:resolution>
<PDBx:nominal_pixel_size>2.64</PDBx:nominal_pixel_size>
<PDBx:actual_pixel_size>2.52</PDBx:actual_pixel_size>
</PDBx:em_3d_reconstruction>
</PDBx:em_3d_reconstructionCategory>
The actual pixel size of projection set of images.
This data item is a pointer to attribute id in category citation in the
CITATION category.
The CTF-correction method.
The Contrast Transfer Function CTF compensation for low contrast
specimens (e.g. frozen-hydrated), for which phase contrast is the only
significant mechanism, then higher defocus levels must be used to
achieve any significant transfer, and several images at different
focus levels must be combined to complete the information lost from
the transfer gaps of any one image. The CTF correction can be applied
to each extracted particle separately or to the whole micrograph after
digitisation. The simplest level of compensation is to reverse phases
at the negative lobes of the CTF.
CTF correction of each particle
Any additional details used in the 3d reconstruction.
The magnification calibration method for the 3d reconstruction.
The algorithm method used for the 3d-reconstruction.
cross-common lines
The nominal pixel size of the projection set of images.
The final resolution (in angstroms)of the 3d reconstruction.
The method used to determine the final resolution
of the 3d reconstruction.
The Fourier Shell Correlation criterion as a measure of
resolution is based on the concept of splitting the (2D)
data set into two halves; averaging each and comparing them
using the Fourier Ring Correlation (FRC) technique.
FSC at 0.5 cut-off
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_3d_reconstruction must
uniquely identify the 3d reconstruction.
Data items in the EM_ASSEMBLY category record details
about the type of complex assembly that describes the
nature of the sample studied.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_assemblyCategory>
<PDBx:em_assembly id="1" entry_id="1DYL">
<PDBx:name>virus</PDBx:name>
<PDBx:aggregation_state>icosahedral</PDBx:aggregation_state>
<PDBx:composition>virus</PDBx:composition>
<PDBx:num_components>1</PDBx:num_components>
</PDBx:em_assembly>
</PDBx:em_assemblyCategory>
A description of the aggregation state of the assembly.
SINGLE PARTICLE
INDIVIDUAL STRUCTURE
2D-CRYSTAL
ICOSAHEDRAL
HELICAL
FILAMENT
HELICAL FILAMENTS
TISSUE
The known composition of the assembly.
A description of any additional details
describing the observed sample.
This structure was preferentially oriented (end-on)on the grid.
The structure was monodisperse.
The value (in megadaltons) of the experimentally
determined molecular weight of the assembly.
The method used in determining
the molecular weight.
The value (in megadaltons) of the theoretically
determined molecular weight of the assembly.
The name of the assembly of observed complexes.
The number of components of the biological assembly.
The value of attribute id in category em_assembly must uniquely identify
a collection of observed complexes.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the BUFFER category
record details of the sample buffer.
Any additional details to do with buffer.
aerated
The name of the buffer.
Acetic acid
The value of attribute id in category em_buffer must
uniquely identify the sample buffer.
Constituents of buffer in sample
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_buffer_componentsCategory>
<PDBx:em_buffer_components buffer_id="1" id="1">
<PDBx:name>NaCl</PDBx:name>
<PDBx:volume>0.200 </PDBx:volume>
<PDBx:conc>4 </PDBx:conc>
</PDBx:em_buffer_components>
<PDBx:em_buffer_components buffer_id="1" id="2">
<PDBx:name>Acetic Acid</PDBx:name>
<PDBx:volume>0.047 </PDBx:volume>
<PDBx:conc>100</PDBx:conc>
</PDBx:em_buffer_components>
<PDBx:em_buffer_components buffer_id="1" id="3">
<PDBx:name>water</PDBx:name>
<PDBx:volume>0.700 </PDBx:volume>
<PDBx:conc>neat</PDBx:conc>
</PDBx:em_buffer_components>
</PDBx:em_buffer_componentsCategory>
The millimolar concentration of buffer component.
200
Any additional details to do with buffer composition.
pH adjusted with NaOH
The name of each buffer component.
Acetic acid
The volume of buffer component.
0.200
This data item is a pointer to attribute id in category em_buffer in the BUFFER category.
The value of attribute id in category em_buffer_components must
uniquely identify a component of the buffer.
Data items in the EM_DETECTOR category record details
of the image detector type.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_detectorCategory>
<PDBx:em_detector entry_id="1DYL" id="1">
<PDBx:type>KODAK SO163 FILM</PDBx:type>
</PDBx:em_detector>
</PDBx:em_detectorCategory>
Any additional information about the detection system.
The detective_quantum_efficiency (DQE)is defined as the
square of the signal-to-noise ratio in the recording device
divided by the square of the signal-to-ratio in the electron beam:
(SIGNAL/NOISE)2 recording device
DQE = -------------------------------
(SIGNAL/NOISE)2 electron beam
A DQE value of 1 indicates a perfect recorder. "DQE = 0.25" menas
that the signal-to-noise ratio is reduced by half in the
recording step.
(0.5)**2
DQE = --------- = 0.25.
(1.0)**2
0.25
The detector type used for recording images.
Usually film or CCD camera.
KODAK SO163 FILM
GATAN 673
GATAN 676
GATAN 692
GATAN 794
GATAN 1000
GATAN 4000
TVIPS BIOCAM
TVIPS TEMCAM F214
TVIPS TEMCAM F224
TVIPS FASTSCAN F114
PROSCAN
AMT
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_detector must uniquely identify
the detector used for imaging.
Data items in the EM_ELECTRON_DIFFRACTION category
record details about the electron diffraction data
from the electron crystallography experiment.
Example 1 - based on PDB entry 1TUB and laboratory records for the
structure corresponding to PDB entry 1TUB
<PDBx:em_electron_diffractionCategory>
<PDBx:em_electron_diffraction entry_id="1TUB" id="1">
<PDBx:num_structure_factors>12000</PDBx:num_structure_factors>
<PDBx:details xsi:nil="true" />
</PDBx:em_electron_diffraction>
</PDBx:em_electron_diffractionCategory>
Details of the electron diffraction experiment
THE MODEL WAS DERIVED USING ELECTRON DIFFRACTION
AND IMAGE DATA FROM TWO DIMENSIONAL CRYSTALS OF TUBULIN
INDUCED BY THE PRESENCE OF ZN++ IONS.
WHAT FOLLOWS ARE THE COORDINATES FOR THE AB-TUBULIN DIMER
BOUND TO TAXOL AS OBTAINED BY ELECTRON CRYSTALLOGRAPHY OF
ZINC-INDUCED SHEETS. THIS IS THE UNREFINED MODEL, BUILT
INTO A RAW DENSITY MAP WHERE THE RESOLUTION IN THE PLANE
OF THE SHEET WAS 3.7 ANGSTROMS AND THAT PERPENDICULAR TO
THE SHEET ABOUT 4.8 ANGSTROMS. THE MODEL DOES NOT CONTAIN
MOST OF THE C-TERMINAL RESIDUES OF EITHER MONOMER WHICH
WERE DISORDERED IN THE MAP. THE LOOP BETWEEN HELIX H1 AND
STRAND S2, AND THAT BETWEEN H2 AND S3 ARE PRESENT FOR
COMPLETENESS BUT WERE BUILT INTO VERY WEAK DENSITY.
GIVEN THE LIMITED RESOLUTION OF THE MAP, THE CONFORMATION
OF THE SIDE CHAINS, ESPECIALLY THOSE CORRESPONDING TO
RESIDUES ON THE SURFACE OF THE DIMER, MUST BE TAKEN
CAUTIOUSLY. IN ADDITION, BECAUSE THIS IS AN UNREFINED
MODEL, CERTAIN GEOMETRY ERRORS MAY STILL BE PRESENT IN THE
STRUCTURE. PLEASE TAKE THIS INTO ACCOUNT WHEN
INTERPRETING YOUR OWN DATA BASED ON THE PRESENT TUBULIN
STRUCTURE. ALTHOUGH THE POSITION OF RESIDUES (WITH THE
EXCEPTION OF THOSE IN THE LOOPS MENTIONED ABOVE) SHOULD
NOT CHANGE SIGNIFICANTLY UPON REFINEMENT, DRAWING
INFORMATION AT THE LEVEL OF SIDE CHAIN CONFORMATION IS
CLEARLY NOT ADVISED. FINALLY, PLEASE NOTICE THAT THE
TAXOID IN THE MODEL IS THE TAXOL DERIVATIVE TAXOTERE.
1
The number of diffraction patterns used from the electron
diffraction experiment.
The number of structure factors from the electron diffraction experiment.
12000
The value of attribute id in category electron_diffraction must
uniquely identify the electron diffraction experiment.
This data item is a pointer to attribute id in category entry in the ENTRY category.
data items in the em_electron_diffraction_pattern category
record details about the pattern information
from the electron diffraction experiment.
example 1 - based on pdb entry 1tub and laboratory records for the
structure corresponding to pdb entry 1tub
<PDBx:em_electron_diffraction_patternCategory>
<PDBx:em_electron_diffraction_pattern entry_id="1TUB" id="1">
<PDBx:num_patterns_by_tilt_angle>1</PDBx:num_patterns_by_tilt_angle>
<PDBx:num_images_by_tilt_angle>4</PDBx:num_images_by_tilt_angle>
</PDBx:em_electron_diffraction_pattern>
</PDBx:em_electron_diffraction_patternCategory>
the number of images by tilt angle.
4
the number of diffraction patterns by tilt angle.
1
the tilt angle at which the diffraction pattern was obtained.
the value of attribute id in category electron_diffraction_pattern must
uniquely identify the electron diffraction pattern experiment.
this data item is a pointer to attribute id in category entry in the entry category.
data items in the em_electron_diffraction_phase category
record details about the phase information
from the electron diffraction experiment.
example 1 - based on pdb entry 1tub and laboratory records for the
structure corresponding to pdb entry 1tub
<PDBx:em_electron_diffraction_phaseCategory>
<PDBx:em_electron_diffraction_phase entry_id="1TUB" id="1">
<PDBx:d_res_high>4.0</PDBx:d_res_high>
</PDBx:em_electron_diffraction_phase>
</PDBx:em_electron_diffraction_phaseCategory>
the highest resolution d-value for the electron diffraction experiment.
5.0
the highest resolution shell error in degrees.
the overall phase error in degrees.
the rejection criteria (phase error) in degrees.
the phase residual value for the electron diffraction experiment.
the value of attribute id in category electron_diffraction_phase must
uniquely identify the electron diffraction phase experiment.
this data item is a pointer to attribute id in category entry in the entry category.
Data items in the EM_ENTITY_ASSEMBLY category
record details about each component of
the complex.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_entity_assemblyCategory>
<PDBx:em_entity_assembly id="1" assembly_id="1">
<PDBx:type>VIRUS</PDBx:type>
</PDBx:em_entity_assembly>
</PDBx:em_entity_assemblyCategory>
Additional details about the component.
The cell from which the component was
obtained.
CHO
HELA
3T3
The cellular location of the component.
cytoplasm
endoplasmic reticulum
plasma membrane
A flag to indicate whether the component is engineered.
The expression system used to produce the component.
eschericia coli
saccharomyces cerevisiae
The plasmid used in the expression system used to produce the component.
pBR322
pMB9
The organelle from which the component was
obtained.
golgi
mitochondrion
cytoskeleton
The common name of the species of the natural organism from which
the component was obtained.
The species of the natural organism from which the component
was obtained.
The strain of the natural organism from which the component was
obtained, if relevant.
DH5a
BMH 71-18
The tissue of the natural organism from which the component was
obtained.
heart
liver
eye lens
The Gene Ontology (GO) identifier for the component.
The GO id is the appropriate identifier used by the Gene Ontology
Consortium. Reference: Nature Genetics vol 25:25-29 (2000).
GO:0005876
GO:0015630
The InterPro (IPR) identifier for the component.
The IPR id is the appropriate identifier used by the Interpro Resource.
Reference: Nucleic Acid Research vol 29(1):37-40(2001).
001304
002353
The name of the component of the observed assembly.
Alternative name of the component.
FADV-1
A description of types of components of the
assembly of the biological structure.
The value of attribute id in category em_entity_assembly must uniquely identify
each of the components of the complex.
This data item is a pointer to attribute id in category em_assembly in the
ASSEMBLY category.
Data items in the EM_ENTITY_ASSEMBLY_LIST category record details
of the structural elements in each component.
Example 1 - microtubule
<PDBx:em_entity_assembly_listCategory>
<PDBx:em_entity_assembly_list entity_assembly_id="1" id="1" entity_id="1">
<PDBx:oligomeric_details>DIMER</PDBx:oligomeric_details>
<PDBx:number_of_copies>2</PDBx:number_of_copies>
</PDBx:em_entity_assembly_list>
</PDBx:em_entity_assembly_listCategory>
The number of copies of the entity.
The oligomeric state of the entity.
This data item is a pointer to attribute id in category em_entity_assembly in
the ENTITY_ASSEMBLY category.
The value of attribute id in category em_entity_assembly_list must uniquely identify
the component.
A pointer to entity id.
Data items in the EM_EULER_ANGLE_DISTRIBUTION category
record details of assignment of Euler angles for projection
sets of particles.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_euler_angle_distributionCategory>
<PDBx:em_euler_angle_distribution entry_id="1DYL" id="1">
</PDBx:em_euler_angle_distribution>
</PDBx:em_euler_angle_distributionCategory>
The euler-alpha angle assignment.
90
The euler-beta angle assignment.
90
Any additional details of the euler angles distribution and assignment.
The euler-gamma angle assignment.
0
The value of attribute id in category em_euler_angle_distribution must
uniquely identify the euler angle assignments of
the projection set used in the final reconstruction.
The value of attribute entry_id in category em_euler_angle_distribution is a pointer
to the ENTRY category.
Data items in the EM_ICOS_VIRUS_SHELLS category record details
of the viral shell number, diameter of each shell and triangulation number.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_icos_virus_shellsCategory>
<PDBx:em_icos_virus_shells virus_entity_id="1" id="1">
<PDBx:shell_diameter>400.</PDBx:shell_diameter>
<PDBx:triangulation_num>4</PDBx:triangulation_num>
</PDBx:em_icos_virus_shells>
</PDBx:em_icos_virus_shellsCategory>
The value of the diameter (in angstroms) for each
protein shell of the virus.
The triangulation number (T number) is a geometric and abstract
concept that does not correspond to the structural components of
an individul virus.
It refers to the organisation of the geometric figure.
The triangulation number, T is given by the following relationship:
T= h*2 + hk +k*2, where h and k are positive integers which define the
position of the five-fold vertex on the original hexagonal net.
4
The value of attribute virus_entity_id in category em_icos_virus_shells is
a pointer to attribute id in category em_virus_entity in the VIRUS_ENTITY
category.
The value of attribute id in category em_em_icos_virus_shells must uniquely identify
the number and diameter of each virus protein shell and its
triangulation number.
Data items in the EM_IMAGE_SCANS category record details
of the image scanning device (microdensitometer)
and parameters for digitization of the image.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_image_scansCategory>
<PDBx:em_image_scans entry_id="1DYL" id="2">
<PDBx:number_digital_images>48</PDBx:number_digital_images>
<PDBx:citation_id>1</PDBx:citation_id>
</PDBx:em_image_scans>
</PDBx:em_image_scansCategory>
This data item is a pointer to attribute id
in category citation in the CITATION category.
Any additional details about scanning images.
The number of images scanned and digitised.
The optical density range (OD=-log 10 transmission).
To the eye OD=1 appears light grey and OD=3 is opaque.
1.4
The number of bits per pixel.
8
The sampling step size (microns) set on the scanner.
The scanner model.
This data item is a pointer to attribute id in category entry in the
ENTRY category.
The value of attribute id in category em_image_scans must uniquely identify
the images scanned.
Data items in the EM_IMAGING category record details about
the parameters used in imaging the sample in the electron microscope.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_imagingCategory>
<PDBx:em_imaging entry_id="1DYL" id="1">
<PDBx:sample_support_id>1</PDBx:sample_support_id>
<PDBx:microscope_model>FEI/PHILIPS CM200 FEG</PDBx:microscope_model>
<PDBx:specimen_holder_type>cryotransfer</PDBx:specimen_holder_type>
<PDBx:specimen_holder_model>gatan 626-0300</PDBx:specimen_holder_model>
<PDBx:date>1998-15-06</PDBx:date>
<PDBx:accelerating_voltage>200</PDBx:accelerating_voltage>
<PDBx:illumination_mode>bright field</PDBx:illumination_mode>
<PDBx:mode>low dose</PDBx:mode>
<PDBx:nominal_cs>2.0</PDBx:nominal_cs>
<PDBx:nominal_defocus_min>975.</PDBx:nominal_defocus_min>
<PDBx:nominal_defocus_max>7600.</PDBx:nominal_defocus_max>
<PDBx:tilt_angle_min>0.</PDBx:tilt_angle_min>
<PDBx:tilt_angle_max>0.</PDBx:tilt_angle_max>
<PDBx:nominal_magnification>50000</PDBx:nominal_magnification>
<PDBx:electron_source>FEG</PDBx:electron_source>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:temperature>95.</PDBx:temperature>
</PDBx:em_imaging>
</PDBx:em_imagingCategory>
A value of accelerating voltage (in kV) used for imaging.
300
The magnification value obtained for a known standard just
prior to, during or just after the imaging experiment.
61200
This data item is a pointer to attribute id in category citation in
the CITATION category.
Date (YYYY-MM-DD) of imaging experiment or the date at which
a series of experiments began.
2001-05-08
Any additional imaging details.
weak beam illumination
The camera length (in millimetres). The camera length is the
product of the objective focal length and the combined magnification
of the intermediate and projector lenses when the microscope is
operated in the diffraction mode.
The value of attribute detector_id in category em_imaging must uniquely identify
the type of detector used in the experiment.
The electron dose received by the specimen (electrons per square angstrom).
0.9
The source of electrons. The electron gun.
FIELD EMISSION GUN
LAB6
TUNGSTEN HAIRPIN
SCHOTTKY FIELD EMISSION GUN
OTHER
The type of energy filter spectrometer apparatus.
FEI
The energy filter range in electron volts (eV)set by spectrometer.
0 - 15
The mode of illumination.
FLOOD BEAM
FLOOD BEAM LOW DOSE
SPOT SCAN
OTHER
The name of the model of microscope.
HITACHI H8100
HITACHI HF2000
HITACHI HF2000-UHR
HITACHI H9000-UHR
HITACHI H9000-NAR
HITACHI 300KEV FEG
HITACHI HU1250
HITACHI H-1500
JEOL 2000EX
JEOL 2010HT
JEOL 2010UHR
JEOL 2010F
JEOL 3010HT
JEOL 3010UHR
JEOL KYOTO-3000SFF
JEOL 4000EX
JEOL HAREM
JEOL ARM-1000
JEOL KYOTO-1000
JEOL ARM-1250
FEI/PHILIPS CM120T
FEI/PHILIPS CM200T
FEI/PHILIPS CM20/ST
FEI/PHILIPS CM20/SOPHIE
FEI/PHILIPS CM200FEG/ST
FEI/PHILIPS CM20/UT
FEI/PHILIPS CM200FEG/UT
FEI/PHILIPS CM30/T
FEI/PHILIPS CM300FEG/T
FEI/PHILIPS CM300FEG/HE
FEI/PHILIPS CM30/ST
FEI/PHILIPS CM300FEG/ST
FEI/PHILIPS CM300FEG/UT
FEI TECNAI 12
FEI TECNAI 20
FEI TECNAI F20
FEI TECNAI F30
FEI MORGAGNI
The mode of imaging.
BRIGHT FIELD
DARK FIELD
DIFFRACTION
OTHER
The spherical aberration coefficient (Cs) in millimetres,
of the objective lens.
1.4
The maximum defocus value of the objective lens (in nanometres) used
to obtain the recorded images.
7600
The minimum defocus value of the objective lens (in nanometres) used
to obtain the recorded images.
975
The magnification indicated by the microscope readout.
60000
The specimen temperature maximum (degrees Kelvin) for the duration
of imaging.
The specimen temperature minimum (degrees Kelvin) for the duration
of imaging.
This data item is a pointer to attribute id in category em_sample_support in
the EM_SAMPLE_SUPPORT category.
The value of attribute scans_id in category em_imaging must uniquely identify
the image_scans used in the experiment.
The name of the model of specimen holder used during imaging.
The type of specimen holder used during imaging.
cryo
The mean specimen stage temperature (degrees Kelvin) during imaging
in the microscope.
The maximum angle at which the specimen was tilted to obtain
recorded images.
60
The minimum angle at which the specimen was tilted to obtain
recorded images.
0
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_imaging must uniquely identify
each imaging experiment.
Data items in the EM_SAMPLE_PREPARATION category
record details of sample conditions prior to loading
onto grid support.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_sample_preparationCategory>
<PDBx:em_sample_preparation entry_id="1DYL" id="1">
<PDBx:ph>7.6</PDBx:ph>
<PDBx:buffer_id>1</PDBx:buffer_id>
<PDBx:sample_concentration>5.</PDBx:sample_concentration>
<PDBx:support_id>1</PDBx:support_id>
</PDBx:em_sample_preparation>
</PDBx:em_sample_preparationCategory>
This data item is a pointer to attribute id
in category em_2d_crystal_grow in the 2D_CRYSTAL_GROW category.
This data item is a pointer to attribute id in category em_buffer in the
BUFFER category.
The pH value of the observed sample buffer.
The value of the concentration (mg/mL for mg per milliliter)
of the complex in the sample.
This data item is a pointer to attribute id
in category em_sample_support in the EM_SAMPLE_SUPPORT category.
The value of attribute id in category em_sample_preparation must
uniquely identify the sample preparation.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EM_SAMPLE_SUPPORT category record details
of the electron microscope grid type, grid support film and pretreatment
of whole before sample is applied
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_sample_supportCategory>
<PDBx:em_sample_support id="1">
<PDBx:film_material>HOLEY CARBON</PDBx:film_material>
<PDBx:grid_material>COPPER</PDBx:grid_material>
<PDBx:grid_mesh_size>400</PDBx:grid_mesh_size>
<PDBx:grid_type>MESH</PDBx:grid_type>
<PDBx:pretreatment>GLOW DISCHARGE</PDBx:pretreatment>
<PDBx:citation_id>2</PDBx:citation_id>
</PDBx:em_sample_support>
</PDBx:em_sample_supportCategory>
This data item is a pointer to attribute id
in category citation in the CITATION category.
A description of any additional details concerning the sample support.
This grid plus sample was kept at -170 deg C for a month before use
The support material covering the em grid.
The name of the material from which the grid is made.
The value of the mesh size (per inch) of the em grid.
400
A description of the grid type.
A description of the method used to produce the support film.
1%formvar in chloroform cast on distilled water
A description of the grid plus support film pretreatment.
glow-discharged for 30 sec in argon
The value of attribute id in category em_sample_support must uniquely identify
the sample support.
Data items in the EM_VIRUS_ENTITY category record details
of the icosahedral virus.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_virus_entityCategory>
<PDBx:em_virus_entity id="1" entity_assembly_id="1">
<PDBx:virus_host_category>VERTERBRATES</PDBx:virus_host_category>
<PDBx:virus_host_species>HOMO SAPIENS</PDBx:virus_host_species>
<PDBx:virus_type>VIRUS</PDBx:virus_type>
<PDBx:virus_isolate>STRAIN</PDBx:virus_isolate>
<PDBx:ictvdb_id>00.073.0.01.023</PDBx:ictvdb_id>
<PDBx:enveloped>YES</PDBx:enveloped>
<PDBx:empty>NO</PDBx:empty>
</PDBx:em_virus_entity>
</PDBx:em_virus_entityCategory>
Additional details about this virus entity
Flag to indicate if the virus is empty or not.
Flag to indicate if the virus is enveloped or not.
The International Committee on Taxonomy of Viruses
(ICTV) Taxon Identifier is the Virus Code used throughout the
ICTV database (ICTVdb). The ICTVdb id is the appropriate
identifier used by the International Committee on Taxonomy of Viruses
Resource. Reference: Virus Taxonomy, Academic Press (1999).
ISBN:0123702003.
01.0.2.0.001
01.0.2.0.002
The host category description for the virus.
ALGAE
ARCHAEA
BACTERIA(EUBACTERIA)
FUNGI
INVERTEBRATES
PLANTAE (HIGHER PLANTS)
PROTOZOA
VERTEBRATES
The host cell from which the virus was isolated.
HELA
CHO
The host species from which the virus was isolated.
homo sapiens
gallus gallus
The isolate from which the virus was obtained.
The type of virus.
VIRION
SATELLITE
PRION
VIROID
VIRUS-LIKE PARTICLE
Is the unique identifier for VIRUS_ENTITY category.
This data item is a pointer to attribute id in category em_virus_entity in the
ENTITY_ASSEMBLY category.
Data items in the EM_VITRIFICATION category
record details about the method and cryogen used in
rapid freezing of the sample on the grid prior to its
insertion in the electron microscope
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_vitrificationCategory>
<PDBx:em_vitrification entry_id="1DYL" id="1">
<PDBx:sample_preparation_id>1</PDBx:sample_preparation_id>
<PDBx:cryogen_name>ETHANE</PDBx:cryogen_name>
<PDBx:humidity>90</PDBx:humidity>
<PDBx:temp>95.</PDBx:temp>
<PDBx:method>PLUNGE VITRIFICATION</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:details> SAMPLES WERE PREPARED AS THIN
LAYERS OF VITREOUS ICE AND
MAINTAINED AT NEAR LIQUID NITROGEN
TEMPERATURE IN THE ELECTRON MICROSCOPE
WITH A GATAN 626-0300 CRYOTRANSFER
HOLDER. </PDBx:details>
</PDBx:em_vitrification>
</PDBx:em_vitrificationCategory>
This data item is a pointer to attribute id in category citation in the
CITATION category.
This is the name of the cryogen.
Any additional details relating to vitrification.
argon atmosphere
The humidity (%) in the vicinity of the vitrification process.
90
The type of instrument used in the vitrification process.
Reichert plunger
The procedure for vitrification.
blot for 2 seconds before plunging
This data item is a pointer to attribute id in category em_sample_preparation in the
EM_SAMPLE_PREPARATION category.
The temperature (in degrees Kelvin) at which vitrification took place.
4.2
The length of time after an event effecting the sample that
vitrification was induced and a description of the event.
30 msec after spraying with effector'
The value of attribute id in category em_vitrification must uniquely identify
the vitrification procedure.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the ENTITY category record details (such as
chemical composition, name and source) about the molecular
entities that are present in the crystallographic structure.
Items in the various ENTITY subcategories provide a full
chemical description of these molecular entities.
Entities are of three types: polymer, non-polymer and water.
Note that the water category includes only water; ordered
solvent such as sulfate ion or acetone would be described as
individual non-polymer entities.
The ENTITY category is specific to macromolecular CIF
applications and replaces the function of the CHEMICAL category
in the CIF core.
It is important to remember that the ENTITY data are not the
result of the crystallographic experiment; those results are
represented by the ATOM_SITE data items. ENTITY data items
describe the chemistry of the molecules under investigation
and can most usefully be thought of as the ideal groups to which
the structure is restrained or constrained during refinement.
It is also important to remember that entities do not correspond
directly to the enumeration of the contents of the asymmetric
unit. Entities are described only once, even in those structures
that contain multiple observations of an entity. The
STRUCT_ASYM data items, which reference the entity list,
describe and label the contents of the asymmetric unit.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entityCategory>
<mmCIF:entity id="1">
<mmCIF:type>polymer</mmCIF:type>
<mmCIF:formula_weight>10916.</mmCIF:formula_weight>
<mmCIF:details> The enzymatically competent form of HIV
protease is a dimer. This entity
corresponds to one monomer of an active dimer.</mmCIF:details>
</mmCIF:entity>
<mmCIF:entity id="2">
<mmCIF:type>non-polymer</mmCIF:type>
<mmCIF:formula_weight>762.</mmCIF:formula_weight>
</mmCIF:entity>
<mmCIF:entity id="3">
<mmCIF:type>water</mmCIF:type>
<mmCIF:formula_weight>18.</mmCIF:formula_weight>
</mmCIF:entity>
</mmCIF:entityCategory>
A description of special aspects of the entity.
Formula mass in daltons of the entity.
A description of the entity, with the name of the entity
in parenthesis.
Maps to PDB compound name.
DNA (5'-D(*GP*(CH3)CP*GP*(CH3)CP*GP*C)-3')
PROFLAVINE
PROTEIN (DEOXYRIBONUCLEASE I (E.C.3.1.21.1))
Enzyme Commission (EC) number(s)
2.7.7.7
Experimentally determined formula mass in daltons of the entity
Method used to determine attribute pdbx_formula_weight_exptl in category entity.
MASS SPEC
Entity fragment description(s).
KLENOW FRAGMENT
REPLICASE OPERATOR HAIRPIN
C-TERMINAL DOMAIN
Description(s) of any chemical or post-translational modifications
Details about any entity mutation(s).
Y31H
DEL(298-323)
A place holder for the number of molecules of the entity in
the entry.
1.0
2.0
3.0
An identifier for the parent entity if this entity
is part of a complex entity. For instance a chimeric
entity may be decomposed into several independent
chemical entities where each component entity was
obtained from a different source.
1
2
3
The value of attribute target_id in category entity points to a TARGETDB target idenitifier
from which this entity was generated.
The method by which the sample for the entity was produced.
Entities isolated directly from natural sources (tissues, soil
samples etc.) are expected to have further information in the
ENTITY_SRC_NAT category. Entities isolated from genetically
manipulated sources are expected to have further information in
the ENTITY_SRC_GEN category.
Defines the type of the entity.
Polymer entities are expected to have corresponding
ENTITY_POLY and associated entries.
Non-polymer entities are expected to have corresponding
CHEM_COMP and associated entries.
Water entities are not expected to have corresponding
entries in the ENTITY category.
The value of attribute id in category entity must uniquely identify a record in the
ENTITY list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ENTITY_KEYWORDS category specify keywords
relevant to the molecular entities. Note that this list of
keywords is separate from the list that is used for the
STRUCT_BIOL data items and is intended to provide only the
information that one would know about the molecular entity *if
one did not know its structure*. Hence polypeptides are simply
polypeptides, not cytokines or beta-alpha-barrels, and
polyribonucleic acids are simply poly-RNA, not transfer-
RNA.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_keywordsCategory>
<mmCIF:entity_keywords entity_id="1" text="polypeptide"></mmCIF:entity_keywords>
<mmCIF:entity_keywords entity_id="2" text="natural product, inhibitor, reduced peptide"></mmCIF:entity_keywords>
</mmCIF:entity_keywordsCategory>
Enzyme Commission (EC) number(s)
2.7.7.7
Entity fragment description(s).
KLENOW FRAGMENT
REPLICASE OPERATOR HAIRPIN
C-TERMINAL DOMAIN
Entity mutation description(s).
Y31H
DEL(298-323)
Keywords describing this entity.
polypeptide
natural product
polysaccharide
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_LINK category give details about
the links between entities.
A description of special aspects of a link between
chemical components in the structure.
The entity ID of the first of the two entities joined by the
link.
This data item is a pointer to attribute id in category entity in the ENTITY
category.
The entity ID of the second of the two entities joined by the
link.
This data item is a pointer to attribute id in category entity in the ENTITY
category.
For a polymer entity, the sequence number in the first of
the two entities containing the link.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
For a polymer entity, the sequence number in the second of
the two entities containing the link.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
This data item is a pointer to attribute id in category chem_link in the
CHEM_LINK category.
Data items in the ENTITY_NAME_COM category record the common name
or names associated with the entity. In some cases, the entity
name may not be the same as the name of the biological structure.
For example, haemoglobin alpha chain would be the entity common
name, not haemoglobin.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_name_comCategory>
<mmCIF:entity_name_com entity_id="1" name="HIV-1 protease monomer"></mmCIF:entity_name_com>
<mmCIF:entity_name_com entity_id="1" name="HIV-1 PR monomer"></mmCIF:entity_name_com>
<mmCIF:entity_name_com entity_id="2" name="acetyl-pepstatin"></mmCIF:entity_name_com>
<mmCIF:entity_name_com entity_id="2" name="acetyl-Ile-Val-Asp-Statine-Ala-Ile-Statine"></mmCIF:entity_name_com>
<mmCIF:entity_name_com entity_id="3" name="water"></mmCIF:entity_name_com>
</mmCIF:entity_name_comCategory>
This data item is a pointer to attribute id in category entity in the ENTITY category.
A common name for the entity.
HIV protease monomer
hemoglobin alpha chain
2-fluoro-1,4-dichloro benzene
arbutin
Data items in the ENTITY_NAME_SYS category record the systematic
name or names associated with the entity and the system that
was used to construct the systematic name. In some cases, the
entity name may not be the same as the name of the biological
structure.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_name_sysCategory>
<mmCIF:entity_name_sys entity_id="1" name="EC 3.4.23.16"></mmCIF:entity_name_sys>
<mmCIF:entity_name_sys entity_id="2" name="acetyl-Ile-Val-Asp-Sta-Ala-Ile-Sta"></mmCIF:entity_name_sys>
<mmCIF:entity_name_sys entity_id="3" name="water"></mmCIF:entity_name_sys>
</mmCIF:entity_name_sysCategory>
The system used to generate the systematic name of the entity.
Chemical Abstracts conventions
enzyme convention
Sigma catalog
This data item is a pointer to attribute id in category entity in the ENTITY category.
The systematic name for the entity.
hydroquinone-beta-D-pyranoside
EC 2.1.1.1
2-fluoro-1,4-dichlorobenzene
Data items in the ENTITY_POLY category record details about the
polymer, such as the type of the polymer, the number of
monomers and whether it has nonstandard features.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_polyCategory>
<mmCIF:entity_poly entity_id="1">
<mmCIF:type>polypeptide(L)</mmCIF:type>
<mmCIF:nstd_chirality>no</mmCIF:nstd_chirality>
<mmCIF:nstd_linkage>no</mmCIF:nstd_linkage>
<mmCIF:nstd_monomer>no</mmCIF:nstd_monomer>
</mmCIF:entity_poly>
</mmCIF:entity_polyCategory>
A flag to indicate whether the polymer contains at least
one monomer unit with chirality different from that specified in
attribute type in category entity_poly.
A flag to indicate whether the polymer contains at least
one monomer-to-monomer link different from that implied by
attribute type in category entity_poly.
A flag to indicate whether the polymer contains at least
one monomer that is not considered standard.
The number of monomers in the polymer.
Chemical sequence expressed as string of one-letter
amino acid codes. Modifications and non-standard
amino acids are coded as X.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
O for water
X for other
Cannonical chemical sequence expressed as string of
one-letter amino acid codes. Modifications are coded
as the parent amino acid where possible.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
The PDB strand/chain id(s) corresponding to this polymer entity.
A
B
A,B,C
The sequence's target identifier registered at target database.
356560
The type of the polymer.
A description of special aspects of the polymer type.
monomer Ala 16 is a D-amino acid
the oligomer contains alternating RNA and DNA units
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_POLY_SEQ category specify the sequence
of monomers in a polymer. Allowance is made for the possibility
of microheterogeneity in a sample by allowing a given sequence
number to be correlated with more than one monomer ID. The
corresponding ATOM_SITE entries should reflect this
heterogeneity.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_poly_seqCategory>
<mmCIF:entity_poly_seq entity_id="1" num="1" mon_id="PRO"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="2" mon_id="GLN"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="3" mon_id="ILE"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="4" mon_id="THR"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="5" mon_id="LEU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="6" mon_id="TRP"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="7" mon_id="GLN"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="8" mon_id="ARG"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="9" mon_id="PRO"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="10" mon_id="LEU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="11" mon_id="VAL"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="12" mon_id="THR"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="13" mon_id="ILE"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="14" mon_id="LYS"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="15" mon_id="ILE"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="16" mon_id="GLY"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="17" mon_id="GLY"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="18" mon_id="GLN"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="19" mon_id="LEU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="20" mon_id="LYS"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="21" mon_id="GLU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="22" mon_id="ALA"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="23" mon_id="LEU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="24" mon_id="LEU"></mmCIF:entity_poly_seq>
<mmCIF:entity_poly_seq entity_id="1" num="25" mon_id="ASP"></mmCIF:entity_poly_seq>
</mmCIF:entity_poly_seqCategory>
A flag to indicate whether this monomer in the polymer is
heterogeneous in sequence. This would be rare.
This data item is a pointer to attribute id in category entity in the ENTITY category.
The value of attribute num in category entity_poly_seq must uniquely and sequentially
identify a record in the ENTITY_POLY_SEQ list.
Note that this item must be a number and that the sequence
numbers must progress in increasing numerical order.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
Data items in the ENTITY_SRC_GEN category record details of
the source from which the entity was obtained in cases
where the source was genetically manipulated. The
following are treated separately: items pertaining to the tissue
from which the gene was obtained, items pertaining to the host
organism for gene expression and items pertaining to the actual
producing organism (plasmid).
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_src_genCategory>
<mmCIF:entity_src_gen entity_id="1">
<mmCIF:gene_src_common_name>HIV-1</mmCIF:gene_src_common_name>
<mmCIF:gene_src_strain>NY-5</mmCIF:gene_src_strain>
<mmCIF:host_org_common_name>bacteria</mmCIF:host_org_common_name>
<mmCIF:host_org_genus>Escherichia</mmCIF:host_org_genus>
<mmCIF:host_org_species>coli</mmCIF:host_org_species>
<mmCIF:plasmid_name>pB322</mmCIF:plasmid_name>
</mmCIF:entity_src_gen>
</mmCIF:entity_src_genCategory>
A unique identifier for the expression system. This
should be extracted from a local list of expression
systems.
The common name of the natural organism from which the gene was
obtained.
man
yeast
bacteria
A description of special aspects of the natural organism from
which the gene was obtained.
A string to indicate the life-cycle or cell development
cycle in which the gene is expressed and the mature
protein is active.
The genus of the natural organism from which the gene was
obtained.
Homo
Saccharomyces
Escherichia
The species of the natural organism from which the gene was
obtained.
sapiens
cerevisiae
coli
The strain of the natural organism from which the gene was
obtained, if relevant.
DH5a
BMH 71-18
The tissue of the natural organism from which the gene was
obtained.
heart
liver
eye lens
The subcellular fraction of the tissue of the natural organism
from which the gene was obtained.
mitochondria
nucleus
membrane
The common name of the organism that served as host for the
production of the entity. Where full details of the protein
production are available it would be expected that this item
be derived from attribute host_org_common_name
in category entity_src_gen_express or via attribute host_org_tax_id in category entity_src_gen_express
yeast
bacteria
A description of special aspects of the organism that served as
host for the production of the entity. Where full details of
the protein production are available it would be expected that
this item would derived from attribute host_org_details in category entity_src_gen_express
The genus of the organism that served as host for the production
of the entity.
Saccharomyces
Escherichia
The species of the organism that served as host for the
production of the entity.
cerevisiae
coli
The strain of the organism in which the entity was expressed.
Where full details of the protein production are available
it would be expected that this item be derived from
attribute host_org_strain in category entity_src_gen_express or via
attribute host_org_tax_id in category entity_src_gen_express
DH5a
BMH 71-18
Information on the source which is not given elsewhere.
American Type Culture Collection tissue culture number.
6051
Cell type.
ENDOTHELIAL
The specific line of cells.
HELA CELLS
Identifies the location inside (or outside) the cell.
CYTOPLASM
NUCLEUS
A domain or fragment of the molecule.
CYTOPLASM
NUCLEUS
Identifies the gene.
NCBI Taxonomy identifier for the gene source organism.
Reference:
Wheeler DL, Chappey C, Lash AE, Leipe DD, Madden TL, Schuler GD,
Tatusova TA, Rapp BA (2000). Database resources of the National
Center for Biotechnology Information. Nucleic Acids Res 2000 Jan
1;28(1):10-4
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Rapp BA,
Wheeler DL (2000). GenBank. Nucleic Acids Res 2000 Jan 1;28(1):15-18.
Organized group of tissues that carries on a specialized function.
KIDNEY
LIVER
PANCREAS
Organized structure within cell.
MITOCHONDRIA
The source plasmid.
The source plasmid.
Scientific name of the organism.
ESCHERICHIA COLI
HOMO SAPIENS
SACCHAROMYCES CEREVISIAE
Identifies the variant.
DELTAH1DELTATRP
Americal Tissue Culture Collection of the expression system. Where
full details of the protein production are available it would
be expected that this item would be derived from
attribute host_org_culture_collection in category entity_src_gen_express
Cell type from which the gene is derived. Where
entity.target_id is provided this should be derived from
details of the target.
ENDOTHELIAL
A specific line of cells used as the expression system. Where
full details of the protein production are available it would
be expected that this item would be derived from
entity_src_gen_express.host_org_cell_line
HELA
Identifies the location inside (or outside) the cell which
expressed the molecule.
CYTOPLASM
NUCLEUS
Culture collection of the expression system. Where
full details of the protein production are available it would
be expected that this item would be derived somehwere, but
exactly where is not clear.
Specific gene which expressed the molecule.
HIV-1 POL
GLNS7
U1A (2-98, Y31H, Q36R)
NCBI Taxonomy identifier for the expression system organism.
Reference:
Wheeler DL, Chappey C, Lash AE, Leipe DD, Madden TL, Schuler GD,
Tatusova TA, Rapp BA (2000). Database resources of the National
Center for Biotechnology Information. Nucleic Acids Res 2000 Jan
1;28(1):10-4
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Rapp BA,
Wheeler DL (2000). GenBank. Nucleic Acids Res 2000 Jan 1;28(1):15-18.
Specific organ which expressed the molecule.
KIDNEY
Specific organelle which expressed the molecule.
MITOCHONDRIA
The scientific name of the organism that served as host for the
production of the entity. Where full details of the protein
production are available it would be expected that this item
would be derived from attribute host_org_scientific_name
in category entity_src_gen_express or via attribute host_org_tax_id in category entity_src_gen_express
ESCHERICHIA COLI
SACCHAROMYCES CEREVISIAE
The strain of the organism in which the entity was
expressed.
AR120
The specific tissue which expressed the molecule. Where full details
of the protein production are available it would be expected that this
item would be derived from attribute host_org_tissue in category entity_src_gen_express
heart
liver
eye lens
The fraction of the tissue which expressed the
molecule.
mitochondria
nucleus
membrane
Variant of the organism used as the expression system. Where
full details of the protein production are available it would
be expected that this item be derived from
entity_src_gen_express.host_org_variant or via
attribute host_org_tax_id in category entity_src_gen_express
TRP-LAC
LAMBDA DE3
Identifies the vector used. Where full details of the protein
production are available it would be expected that this item
would be derived from attribute vector_name in category entity_src_gen_clone.
PBIT36
PET15B
PUC18
Identifies the type of vector used (plasmid, virus, or cosmid).
Where full details of the protein production are available it
would be expected that this item would be derived from
attribute vector_type in category entity_src_gen_express.
COSMID
PLASMID
A description of special aspects of the plasmid that produced the
entity in the host organism. Where full details of the protein
production are available it would be expected that this item
would be derived from attribute details in category pdbx_construct of the construct
pointed to from attribute plasmid_id in category entity_src_gen_express.
The name of the plasmid that produced the entity in the host
organism. Where full details of the protein production are available
it would be expected that this item would be derived from
attribute name in category pdbx_construct of the construct pointed to from
attribute plasmid_id in category entity_src_gen_express.
pET3C
pT123sab
A pointer to attribute id in category pdbx_construct in the PDBX_CONSTRUCT category.
The indentified sequence is the initial construct.
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_SRC_NAT category record details of
the source from which the entity was obtained in cases
where the entity was isolated directly from a natural tissue.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entity_src_natCategory>
<mmCIF:entity_src_nat entity_id="2">
<mmCIF:common_name>bacteria</mmCIF:common_name>
<mmCIF:genus>Actinomycetes</mmCIF:genus>
<mmCIF:species xsi:nil="true" />
<mmCIF:details> Acetyl-pepstatin was isolated by Dr. K. Oda, Osaka
Prefecture University, and provided to us by Dr. Ben
Dunn, University of Florida, and Dr. J. Kay, University
of Wales.</mmCIF:details>
</mmCIF:entity_src_nat>
</mmCIF:entity_src_natCategory>
The common name of the organism from which the entity
was isolated.
man
yeast
bacteria
A description of special aspects of the organism from which the
entity was isolated.
The genus of the organism from which the entity was isolated.
Homo
Saccharomyces
Escherichia
Americal Tissue Culture Collection number.
6051
A particular cell type.
BHK-21
The specific line of cells.
HELA
Identifies the location inside (or outside) the cell.
A domain or fragment of the molecule.
NCBI Taxonomy identifier for the source organism.
Reference:
Wheeler DL, Chappey C, Lash AE, Leipe DD, Madden TL, Schuler GD,
Tatusova TA, Rapp BA (2000). Database resources of the National
Center for Biotechnology Information. Nucleic Acids Res 2000 Jan
1;28(1):10-4
Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Rapp BA,
Wheeler DL (2000). GenBank. Nucleic Acids Res 2000 Jan 1;28(1):15-18.
Organized group of tissues that carries on a specialized function.
KIDNEY
Organized structure within cell.
MITOCHONDRIA
Scientific name of the organism of the natural source.
BOS TAURUS
SUS SCROFA
ASPERGILLUS ORYZAE
Details about the plasmid.
PLC28 DERIVATIVE
The plasmid containing the gene.
pB322
Identifies the secretion from which the molecule was isolated.
saliva
urine
venom
Identifies the variant.
The species of the organism from which the entity was isolated.
sapiens
cerevisiae
coli
The strain of the organism from which the entity was isolated.
DH5a
BMH 71-18
The tissue of the organism from which the entity was isolated.
heart
liver
eye lens
The subcellular fraction of the tissue of the organism from
which the entity was isolated.
mitochondria
nucleus
membrane
This data item is a pointer to attribute id in category entity in the ENTITY category.
There is only one item in the ENTRY category, attribute id in category entry. This
data item gives a name to this entry and is indirectly a key to
the categories (such as CELL, GEOM, EXPTL) that describe
information pertinent to the entire data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:entryCategory>
<mmCIF:entry id="5HVP"></mmCIF:entry>
</mmCIF:entryCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:entryCategory>
<mmCIF:entry id="TOZ"></mmCIF:entry>
</mmCIF:entryCategory>
Document Object Identifier (DOI) for this entry registered
with http://crossref.org.
The value of attribute id in category entry identifies the data block.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ENTRY_LINK category record the
relationships between the current data block
identified by attribute id in category entry and other data blocks
within the current file which may be referenced
in the current data block.
Example 1 - example file for the one-dimensional incommensurately
modulated structure of K~2~SeO~4~.
<mmCIF:entry_linkCategory>
<mmCIF:entry_link id="KSE_COM" entry_id="KSE_TEXT">
<mmCIF:details>experimental data common to ref./mod. structures</mmCIF:details>
</mmCIF:entry_link>
<mmCIF:entry_link id="KSE_REF" entry_id="KSE_TEXT">
<mmCIF:details>reference structure</mmCIF:details>
</mmCIF:entry_link>
<mmCIF:entry_link id="KSE_MOD" entry_id="KSE_TEXT">
<mmCIF:details>modulated structure</mmCIF:details>
</mmCIF:entry_link>
</mmCIF:entry_linkCategory>
A description of the relationship between the data blocks
identified by _entry_link.id and _entry_link.entry_id.
The value of attribute id in category entry_link identifies a data block
related to the current data block.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EXPTL category record details about the
experimental work prior to the intensity measurements and
details about the absorption-correction technique employed.
Example 1 - based on laboratory records for Yb(S-C5H4N)2(THF)4.
<mmCIF:exptlCategory>
<mmCIF:exptl entry_id="datablock1">
<mmCIF:absorpt_coefficient_mu>1.22</mmCIF:absorpt_coefficient_mu>
<mmCIF:absorpt_correction_T_max>0.896</mmCIF:absorpt_correction_T_max>
<mmCIF:absorpt_correction_T_min>0.802</mmCIF:absorpt_correction_T_min>
<mmCIF:absorpt_correction_type>integration</mmCIF:absorpt_correction_type>
<mmCIF:absorpt_process_details> Gaussian grid method from SHELX76
Sheldrick, G. M., "SHELX-76: structure determination and
refinement program", Cambridge University, UK, 1976</mmCIF:absorpt_process_details>
<mmCIF:crystals_number>1</mmCIF:crystals_number>
<mmCIF:details> Enraf-Nonius LT2 liquid nitrogen variable-temperature
device used</mmCIF:details>
<mmCIF:method>single-crystal x-ray diffraction</mmCIF:method>
<mmCIF:method_details> graphite monochromatized Cu K(alpha) fixed tube and
Enraf-Nonius CAD4 diffractometer used</mmCIF:method_details>
</mmCIF:exptl>
</mmCIF:exptlCategory>
The absorption coefficient mu in reciprocal millimetres
calculated from the atomic content of the cell, the density and
the radiation wavelength.
The maximum transmission factor for the crystal and radiation.
The maximum and minimum transmission factors are also referred
to as the absorption correction
A or 1/A*.
The minimum transmission factor for the crystal and radiation.
The maximum and minimum transmission factors are also referred
to as the absorption correction
A or 1/A*.
The absorption correction type and method. The value
'empirical' should NOT be used unless more detailed
information is not available.
Description of the absorption process applied to the
intensities. A literature reference should be supplied for
psi-scan techniques.
Tompa analytical
The total number of crystals used in the measurement of
intensities.
Any special information about the experimental work prior to the
intensity measurement. See also attribute preparation in category exptl_crystal.
The method used in the experiment.
single-crystal x-ray diffraction
single-crystal neutron diffraction
single-crystal electron diffraction
fiber x-ray diffraction
fiber neutron diffraction
fiber electron diffraction
single-crystal joint x-ray and neutron diffraction
single-crystal joint x-ray and electron diffraction
solution nmr
solid-state nmr
theoretical model
other
A description of special aspects of the experimental method.
29 structures
minimized average structure
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EXPTL_CRYSTAL category record the results of
experimental measurements on the crystal or crystals used,
such as shape, size or density.
Example 1 - based on laboratory records for Yb(S-C5H4N)2(THF)4.
<mmCIF:exptl_crystalCategory>
<mmCIF:exptl_crystal id="xst2l">
<mmCIF:colour>pale yellow</mmCIF:colour>
<mmCIF:density_diffrn>1.113</mmCIF:density_diffrn>
<mmCIF:density_Matthews>1.01</mmCIF:density_Matthews>
<mmCIF:density_meas>1.11</mmCIF:density_meas>
<mmCIF:density_meas_temp>294.5</mmCIF:density_meas_temp>
<mmCIF:density_method>neutral buoyancy</mmCIF:density_method>
<mmCIF:density_percent_sol>0.15</mmCIF:density_percent_sol>
<mmCIF:description>hexagonal rod, uncut</mmCIF:description>
<mmCIF:F_000>202</mmCIF:F_000>
<mmCIF:preparation> hanging drop, crystal soaked in 10% ethylene glycol for
10 h, then placed in nylon loop at data collection time</mmCIF:preparation>
<mmCIF:size_max>0.30</mmCIF:size_max>
<mmCIF:size_mid>0.20</mmCIF:size_mid>
<mmCIF:size_min>0.05</mmCIF:size_min>
<mmCIF:size_rad>0.025</mmCIF:size_rad>
</mmCIF:exptl_crystal>
</mmCIF:exptl_crystalCategory>
Example 2 - using separate items to define upper and lower
limits for a value.
<mmCIF:exptl_crystalCategory>
<mmCIF:exptl_crystal>
<mmCIF:density_meas_gt>2.5</mmCIF:density_meas_gt>
<mmCIF:density_meas_lt>5.0</mmCIF:density_meas_lt>
</mmCIF:exptl_crystal>
</mmCIF:exptl_crystalCategory>
Example 3 - here the density was measured at some
unspecified temperature below room temperature.
<mmCIF:exptl_crystalCategory>
<mmCIF:exptl_crystal>
<mmCIF:density_meas_temp_lt>300.</mmCIF:density_meas_temp_lt>
</mmCIF:exptl_crystal>
</mmCIF:exptl_crystalCategory>
The effective number of electrons in the crystal unit cell
contributing to F(000). This may contain dispersion contributions
and is calculated as
F(000) = [ sum (f~r~^2^ + f~i~^2^) ]^1/2^
f~r~ = real part of the scattering factors at theta = 0 degree
f~i~ = imaginary part of the scattering factors at
theta = 0 degree
the sum is taken over each atom in the unit cell
The colour of the crystal.
dark green
The enumeration list of standardized names developed for the
International Centre for Diffraction Data.
The colour of a crystal is given by the combination of
attribute colour_modifier in category exptl_crystal with
attribute colour_primary in category exptl_crystal as in 'dark-green' or
'bluish-violet', if necessary combined with
attribute colour_lustre in category exptl_crystal as in 'metallic-green'.
The enumeration list of standardized names developed for the
International Centre for Diffraction Data.
The colour of a crystal is given by the combination of
attribute colour_modifier in category exptl_crystal with
attribute colour_primary in category exptl_crystal as in 'dark-green' or
'bluish-violet', if necessary combined with
attribute colour_lustre in category exptl_crystal as in 'metallic-green'.
The enumeration list of standardized names developed for the
International Centre for Diffraction Data.
The colour of a crystal is given by the combination of
attribute colour_modifier in category exptl_crystal with
attribute colour_primary in category exptl_crystal as in 'dark-green' or
'bluish-violet', if necessary combined with
attribute colour_lustre in category exptl_crystal as in 'metallic-green'.
The density of the crystal, expressed as the ratio of the
volume of the asymmetric unit to the molecular mass of a
monomer of the structure, in units of angstroms^3^ per dalton.
Ref: Matthews, B. W. (1968). J. Mol. Biol. 33, 491-497.
Density values calculated from the crystal cell and contents. The
units are megagrams per cubic metre (grams per cubic centimetre).
Density values measured using standard chemical and physical
methods. The units are megagrams per cubic metre (grams per
cubic centimetre).
The estimated standard deviation of attribute density_meas in category exptl_crystal.
The value above which the density measured using standard
chemical and physical methods lies. The units are megagrams
per cubic metre (grams per cubic centimetre).
_exptl_crystal.density_meas_gt and _exptl_crystal.density_meas_lt
should not be used to report new experimental work, for which
attribute density_meas in category exptl_crystal should be used. These items are
intended for use in reporting information in existing databases
and archives which would be misleading if reported under
attribute density_meas in category exptl_crystal.
lower limit for the density (only the range
within which the density lies was given in the
original paper)
2.5
The value below which the density measured using standard
chemical and physical methods lies. The units are megagrams
per cubic metre (grams per cubic centimetre).
_exptl_crystal.density_meas_gt and _exptl_crystal.density_meas_lt
should not be used to report new experimental work, for which
attribute density_meas in category exptl_crystal should be used. These items are
intended for use in reporting information in existing databases
and archives which would be misleading if reported under
attribute density_meas in category exptl_crystal.
specimen floats in water
1.0
upper limit for the density (only the range
within which the density lies was given in the
original paper)
5.0
Temperature in kelvins at which attribute density_meas
in category exptl_crystal was determined.
The estimated standard deviation of
attribute density_meas_temp in category exptl_crystal.
Temperature in kelvins above which attribute density_meas
in category exptl_crystal was determined. attribute density_meas_temp_gt in category exptl_crystal and
attribute density_meas_temp_lt in category exptl_crystal should not be used for
reporting new work, for which the correct temperature of
measurement should be given. These items are intended for
use in reporting information stored in databases or archives
which would be misleading if reported under
attribute density_meas_temp in category exptl_crystal.
Temperature in kelvins below which attribute density_meas
in category exptl_crystal was determined. attribute density_meas_temp_gt in category exptl_crystal and
attribute density_meas_temp_lt in category exptl_crystal should not be used for
reporting new work, for which the correct temperature of
measurement should be given. These items are intended for
use in reporting information stored in databases or archives
which would be misleading if reported under
attribute density_meas_temp in category exptl_crystal.
The density was measured at some unspecified
temperature below room temperature.
300
The method used to measure attribute density_meas in category exptl_crystal.
Density value P calculated from the crystal cell and contents,
expressed as per cent solvent.
P = 1 - (1.23 N MMass) / V
N = the number of molecules in the unit cell
MMass = the molecular mass of each molecule (gm/mole)
V = the volume of the unit cell (A^3^)
1.23 = a conversion factor evaluated as:
(0.74 cm^3^/g) (10^24^ A^3^/cm^3^)
--------------------------------------
(6.02*10^23^) molecules/mole
where 0.74 is an assumed value for the partial specific
volume of the molecule
A description of the quality and habit of the crystal.
The crystal dimensions should not normally be reported here;
use instead the specific items in the EXPTL_CRYSTAL category
relating to size for the gross dimensions of the crystal and
data items in the EXPTL_CRYSTAL_FACE category to describe the
relationship between individual faces.
The image format for the file containing the image of crystal specified
as an RFC2045/RFC2046 mime type.
jpeg
gif
tiff
The URL for an a file containing the image of crystal.
Details of crystal growth and preparation of the crystal (e.g.
mounting) prior to the intensity measurements.
mounted in an argon-filled quartz capillary
The maximum dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The medial dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The minimum dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The radius of the crystal, if the crystal is a sphere or a
cylinder. This item may appear in a list with attribute id
in category exptl_crystal if multiple crystals are used in the experiment.
The value of attribute id in category exptl_crystal must uniquely identify a record in
the EXPTL_CRYSTAL list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the EXPTL_CRYSTAL_FACE category record details
of the crystal faces.
Example 1 - based on laboratory records for Yb(S-C5H4N)2(THF)4
for the 100 face of crystal xstl1.
<mmCIF:exptl_crystal_faceCategory>
<mmCIF:exptl_crystal_face crystal_id="xstl1" index_h="1" index_k="0" index_l="0">
<mmCIF:diffr_chi>42.56</mmCIF:diffr_chi>
<mmCIF:diffr_kappa>30.23</mmCIF:diffr_kappa>
<mmCIF:diffr_phi>-125.56</mmCIF:diffr_phi>
<mmCIF:diffr_psi>-0.34</mmCIF:diffr_psi>
<mmCIF:perp_dist>0.025</mmCIF:perp_dist>
</mmCIF:exptl_crystal_face>
</mmCIF:exptl_crystal_faceCategory>
The chi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The kappa diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The phi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The psi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The perpendicular distance in millimetres from the face to the
centre of rotation of the crystal.
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Miller index h of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Miller index k of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Miller index l of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Data items in the EXPTL_CRYSTAL_GROW category record details
about the conditions and methods used to grow the crystal.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:exptl_crystal_growCategory>
<mmCIF:exptl_crystal_grow crystal_id="1">
<mmCIF:method>hanging drop</mmCIF:method>
<mmCIF:apparatus>Linbro plates</mmCIF:apparatus>
<mmCIF:atmosphere>room air</mmCIF:atmosphere>
<mmCIF:pH>4.7</mmCIF:pH>
<mmCIF:temp>18(3).</mmCIF:temp>
<mmCIF:time>approximately 2 days</mmCIF:time>
</mmCIF:exptl_crystal_grow>
</mmCIF:exptl_crystal_growCategory>
The physical apparatus in which the crystal was grown.
Linbro plate
sandwich box
ACA plates
The nature of the gas or gas mixture in which the crystal was
grown.
room air
nitrogen
argon
A description of special aspects of the crystal growth.
Solution 2 was prepared as a well solution and
mixed. A droplet containing 2 \ml of solution
1 was delivered onto a cover slip; 2 \ml of
solution 2 was added to the droplet without
mixing.
Crystal plates were originally stored at room
temperature for 1 week but no nucleation
occurred. They were then transferred to 4
degrees C, at which temperature well formed
single crystals grew in 2 days.
The dependence on pH for successful crystal
growth is very sharp. At pH 7.4 only showers
of tiny crystals grew, at pH 7.5 well formed
single crystals grew, at pH 7.6 no
crystallization occurred at all.
The method used to grow the crystals.
batch precipitation
batch dialysis
hanging drop vapor diffusion
sitting drop vapor diffusion
A literature reference that describes the method used to grow
the crystals.
McPherson et al., 1988
The pH at which the crystal was grown. If more than one pH was
employed during the crystallization process, the final pH should
be noted here and the protocol involving multiple pH values
should be described in attribute details in category exptl_crystal_grow.
7.4
7.6
4.3
Text description of crystal grow procedure.
PEG 4000, potassium phosphate, magnesium chloride, cacodylate
The range of pH values at which the crystal was grown. Used when
a point estimate of pH is not appropriate.
5.6 - 6.4
The ambient pressure in kilopascals at which the crystal was
grown.
The standard uncertainty (estimated standard deviation)
of attribute pressure in category exptl_crystal_grow.
A description of the protocol used for seeding the crystal
growth.
macroseeding
Microcrystals were introduced from a previous
crystal growth experiment by transfer with a
human hair.
A literature reference that describes the protocol used to seed
the crystal.
Stura et al., 1989
The temperature in kelvins at which the crystal was grown.
If more than one temperature was employed during the
crystallization process, the final temperature should be noted
here and the protocol involving multiple temperatures should be
described in attribute details in category exptl_crystal_grow.
A description of special aspects of temperature control during
crystal growth.
The standard uncertainty (estimated standard deviation)
of attribute temp in category exptl_crystal_grow.
The approximate time that the crystal took to grow to the size
used for data collection.
overnight
2-4 days
6 months
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Data items in the EXPTL_CRYSTAL_GROW_COMP category record
details about the components of the solutions that were 'mixed'
(by whatever means) to produce the crystal.
In general, solution 1 is the solution that contains the
molecule to be crystallized and solution 2 is the solution
that contains the precipitant. However, the number of solutions
required to describe the crystallization protocol is not limited
to 2.
Details of the crystallization protocol should be given in
attribute details in category exptl_crystal_grow_comp using the solutions
described in EXPTL_CRYSTAL_GROW_COMP.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP.
<mmCIF:exptl_crystal_grow_compCategory>
<mmCIF:exptl_crystal_grow_comp crystal_id="1" id="1">
<mmCIF:sol_id>1</mmCIF:sol_id>
<mmCIF:name>HIV-1 protease</mmCIF:name>
<mmCIF:volume>0.002 ml</mmCIF:volume>
<mmCIF:conc>6 mg/ml</mmCIF:conc>
<mmCIF:details> The protein solution was in a buffer containing 25 mM NaCl,
100 mM NaMES/ MES buffer, pH 7.5, 3 mM NaAzide</mmCIF:details>
</mmCIF:exptl_crystal_grow_comp>
<mmCIF:exptl_crystal_grow_comp crystal_id="1" id="2">
<mmCIF:sol_id>2</mmCIF:sol_id>
<mmCIF:name>NaCl</mmCIF:name>
<mmCIF:volume>0.200 ml</mmCIF:volume>
<mmCIF:conc>4 M</mmCIF:conc>
<mmCIF:details>in 3 mM NaAzide</mmCIF:details>
</mmCIF:exptl_crystal_grow_comp>
<mmCIF:exptl_crystal_grow_comp crystal_id="1" id="3">
<mmCIF:sol_id>2</mmCIF:sol_id>
<mmCIF:name>Acetic Acid</mmCIF:name>
<mmCIF:volume>0.047 ml</mmCIF:volume>
<mmCIF:conc>100 mM</mmCIF:conc>
<mmCIF:details>in 3 mM NaAzide</mmCIF:details>
</mmCIF:exptl_crystal_grow_comp>
<mmCIF:exptl_crystal_grow_comp crystal_id="1" id="4">
<mmCIF:sol_id>2</mmCIF:sol_id>
<mmCIF:name>Na Acetate</mmCIF:name>
<mmCIF:volume>0.053 ml</mmCIF:volume>
<mmCIF:conc>100 mM</mmCIF:conc>
<mmCIF:details> in 3 mM NaAzide. Buffer components were mixed to produce a
pH of 4.7 according to a ratio calculated from the pKa. The
actual pH of solution 2 was not measured.</mmCIF:details>
</mmCIF:exptl_crystal_grow_comp>
<mmCIF:exptl_crystal_grow_comp crystal_id="1" id="5">
<mmCIF:sol_id>2</mmCIF:sol_id>
<mmCIF:name>water</mmCIF:name>
<mmCIF:volume>0.700 ml</mmCIF:volume>
<mmCIF:conc>neat</mmCIF:conc>
<mmCIF:details>in 3 mM NaAzide</mmCIF:details>
</mmCIF:exptl_crystal_grow_comp>
</mmCIF:exptl_crystal_grow_compCategory>
The concentration of the solution component.
200 \ml
0.1 ml
A description of any special aspects of the solution component.
When the solution component is the one that contains the
macromolecule, this could be the specification of the buffer in
which the macromolecule was stored. When the solution component
is a buffer component, this could be the methods (or formula)
used to achieve a desired pH.
in 3 mM NaAzide
The protein solution was in a buffer
containing 25 mM NaCl, 100 mM NaMES/MES
buffer, pH 7.5, 3 mM NaAzide
in 3 mM NaAzide. Buffer components were mixed
to produce a pH of 4.7 according to a ratio
calculated from the pKa. The actual pH of
solution 2 was not measured.
A common name for the component of the solution.
protein in buffer
acetic acid
An identifier for the solution to which the given solution
component belongs.
1
well solution
solution A
The volume of the solution component.
200 \ml
0.1 ml
The value of attribute id in category exptl_crystal_grow_comp must uniquely identify
each item in the EXPTL_CRYSTAL_GROW_COMP list.
Note that this item need not be a number; it can be any unique
identifier.
1
A
protein in buffer
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Data items in the GEOM and related (GEOM_ANGLE,
GEOM_BOND, GEOM_CONTACT, GEOM_HBOND and GEOM_TORSION)
categories record details about the molecular
geometry as calculated from the contents of the ATOM, CELL
and SYMMETRY data.
Geometry data are therefore redundant, in that they can be
calculated from other more fundamental quantities in the data
block. However, they provide a check on the correctness of
both sets of data and enable the most important geometric data
to be identified for publication by setting the appropriate
publication flag.
A description of geometry not covered by the
existing data names in the GEOM categories, such as
least-squares planes.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the GEOM_ANGLE category record details about the
bond angles as calculated from the contents
of the ATOM, CELL and SYMMETRY data.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:geom_angleCategory>
<mmCIF:geom_angle atom_site_id_1="C2" atom_site_id_2="O1" atom_site_id_3="C5" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>111.6</mmCIF:value>
<mmCIF:value_esd>0.2</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="O1" atom_site_id_2="C2" atom_site_id_3="C3" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>110.9</mmCIF:value>
<mmCIF:value_esd>0.2</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="O1" atom_site_id_2="C2" atom_site_id_3="O21" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>122.2</mmCIF:value>
<mmCIF:value_esd>0.3</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="C3" atom_site_id_2="C2" atom_site_id_3="O21" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>127.0</mmCIF:value>
<mmCIF:value_esd>0.3</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="N4" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>101.3</mmCIF:value>
<mmCIF:value_esd>0.2</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="C31" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>111.3</mmCIF:value>
<mmCIF:value_esd>0.2</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="H3" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>107.</mmCIF:value>
<mmCIF:value_esd>1.</mmCIF:value_esd>
<mmCIF:publ_flag>no</mmCIF:publ_flag>
</mmCIF:geom_angle>
<mmCIF:geom_angle atom_site_id_1="N4" atom_site_id_2="C3" atom_site_id_3="C31" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<mmCIF:value>116.7</mmCIF:value>
<mmCIF:value_esd>0.2</mmCIF:value_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_angle>
</mmCIF:geom_angleCategory>
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals whether the angle is referred to in a
publication or should be placed in a table of significant angles.
Angle in degrees defined by the three sites
_geom_angle.atom_site_id_1, _geom_angle.atom_site_id_2 and
attribute atom_site_id_3 in category geom_angle.
The standard uncertainty (estimated standard deviation)
of attribute value in category geom_angle.
The identifier of the first of the three atom sites that define
the angle.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the three atom sites that define
the angle. The second atom is taken to be the apex of the angle.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the third of the three atom sites that define
the angle.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the three atom sites that
define the angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the three atom sites that
define the angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the third of the three atom sites that
define the angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_BOND category record details about
the bond lengths as calculated from the contents
of the ATOM, CELL and SYMMETRY data.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer
[Acta Cryst. (1991), C47, 2276-2277].
<mmCIF:geom_bondCategory>
<mmCIF:geom_bond atom_site_id_1="O1" atom_site_id_2="C2" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.342</mmCIF:dist>
<mmCIF:dist_esd>0.004</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="O1" atom_site_id_2="C5" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.439</mmCIF:dist>
<mmCIF:dist_esd>0.003</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="C2" atom_site_id_2="C3" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.512</mmCIF:dist>
<mmCIF:dist_esd>0.004</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="C2" atom_site_id_2="O21" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.199</mmCIF:dist>
<mmCIF:dist_esd>0.004</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="C3" atom_site_id_2="N4" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.465</mmCIF:dist>
<mmCIF:dist_esd>0.003</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="C3" atom_site_id_2="C31" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.537</mmCIF:dist>
<mmCIF:dist_esd>0.004</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="C3" atom_site_id_2="H3" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.00</mmCIF:dist>
<mmCIF:dist_esd>0.03</mmCIF:dist_esd>
<mmCIF:publ_flag>no</mmCIF:publ_flag>
</mmCIF:geom_bond>
<mmCIF:geom_bond atom_site_id_1="N4" atom_site_id_2="C5" site_symmetry_1="1_555" site_symmetry_2="1_555">
<mmCIF:dist>1.472</mmCIF:dist>
<mmCIF:dist_esd>0.003</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_bond>
</mmCIF:geom_bondCategory>
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
The intramolecular bond distance in angstroms.
The standard uncertainty (estimated standard deviation)
of attribute dist in category geom_bond.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals whether the bond distance is referred to in a
publication or should be placed in a list of significant bond
distances.
The bond valence calculated from attribute dist in category geom_bond.
The identifier of the first of the two atom sites that define the
bond.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the two atom sites that define
the bond.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the two atom sites that
define the bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the two atom sites that
define the bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_CONTACT category record details about
interatomic contacts as calculated from the contents
of the ATOM, CELL and SYMMETRY data.
Example 1 - based on data set CLPHO6 of Ferguson, Ruhl, McKervey & Browne
[Acta Cryst. (1992), C48, 2262-2264].
<mmCIF:geom_contactCategory>
<mmCIF:geom_contact atom_site_id_1="O(1)" atom_site_id_2="O(2)" site_symmetry_1="" site_symmetry_2="">
<mmCIF:dist>2.735</mmCIF:dist>
<mmCIF:dist_esd>0.003</mmCIF:dist_esd>
<mmCIF:publ_flag>yes</mmCIF:publ_flag>
</mmCIF:geom_contact>
<mmCIF:geom_contact atom_site_id_1="H(O1)" atom_site_id_2="O(2)" site_symmetry_1="" site_symmetry_2="">
<mmCIF:dist>1.82</mmCIF:dist>
<mmCIF:publ_flag>no</mmCIF:publ_flag>
</mmCIF:geom_contact>
</mmCIF:geom_contactCategory>
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact.
This data item is