Data Item _entity_poly.pdbx_seq_one_letter

Browse:

General

Item name: _entity_poly.pdbx_seq_one_letter_code
Category name: entity_poly
Attribute name: pdbx_seq_one_letter_code
Required in PDB entries: no
Required for PDB deposition: yes
Used in current PDB entries: Yes, in about 100.0 % of entries

Item Description

Chemical sequence expressed as string of one-letter amino acid codes. Non-standard amino acids and nucleotides are coded in parenthesis. A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil O for water X for other (MSE) for selenomethionine

Additional Descriptive Information for Depositors

               Chemical sequence expressed as string of one-letter
               amino acid codes. Non-standard amino acids and
               nucleotides are coded in parenthesis.

A     for alanine or adenine
B     for ambiguous asparagine/aspartic-acid
R     for arginine
N     for asparagine
D     for aspartic-acid
C     for cysteine or cystine or cytosine
Q     for glutamine
E     for glutamic-acid
Z     for ambiguous glutamine/glutamic acid
G     for glycine or guanine
H     for histidine
I     for isoleucine
L     for leucine
K     for lysine
M     for methionine
F     for phenylalanine
P     for proline
S     for serine
T     for threonine or thymine
W     for tryptophan
Y     for tyrosine
V     for valine
U     for uracil
O     for water
X     for other
(MSE) for selenomethionine

Item Example

View/hide Example

 
(MSE)SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD

Additional Item Example for Depositors

View/hide Example

 HHHH(MSE)AKQRSG or AUCGGAAU

Data Type

Data type code: text
Data type detail: text item types / multi-line text ...
Primitive data type code: char
Regular expression: [][ \n\t()_,.;:"&<>/\{}'`~!@#$%?+=*A-Za-z0-9|^-]*
Deposition data type: sequence_dep
Deposition regular expression: [a-zA-Z0-9\t \r\n\v\f]+$

Aliases

Alias Item Name	Dictionary Name	Dictionary Version
_entity_poly.ndb_seq_one_letter_code	cif_rcsb.dic	1.1